Gene Information

Name : Npun_R5983 (Npun_R5983)
Accession : YP_001869217.1
Strain : Nostoc punctiforme PCC 73102
Genome accession: NC_010628
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7390344 - 7390949 bp
Length : 606 bp
Strand : -
Note : PFAM: stress protein; KEGG: bsu:BG12767 similar to tellurium resistance protein

DNA sequence : 
ATGGCAATTAGTTTACAGAAAGGACAGCGGATTTCACTTTCTAAGGAAGCCCCTGGTCTAAGCAAAATGATGTGTGGACT
GGGCTGGGATGTGGCTAAACGTTCAGGCGGTGGATTTTTTAGTAATTTTGGTGGCGGTGGTCAAAACTATGATCTAGATG
CATCTGTAATCTGTCTGGATGCAAATGGCAAGTTAACGGCTAAAGAGAATATTATCTACTTTGGAAATCTTCAGCATTTG
TCTGGAGCCATAACTCACACAGGGGACAATTTAACTGGTGCAGGTGATGGCGATGATGAAGTGATTATAGTTGATTTGCC
GCGCATACCTGCCCAGATTGTTAAGTTAGTCTTCGTAGTCAATATTTACGATTGCATTGCCCGTAAGCAGGACTTTAGTC
AAATTGAAAATGCTTTTGTGCGCCTGGTTAATGCAGCTAATAACAAAGAACTGGCTCGATATAATCTCTCTGGTAAGGAG
TATTTGGGCATGACTGGGATGGTCTTGGCTGAAGTGTATCGACACAATGATGACTGGAAACTAGCAGCTATTGGCAATGG
TGTCAATGTCAATGGCTTAGGTGAACTCGCTGGCTCTTACTCCTAA

Protein sequence : 
MAISLQKGQRISLSKEAPGLSKMMCGLGWDVAKRSGGGFFSNFGGGGQNYDLDASVICLDANGKLTAKENIIYFGNLQHL
SGAITHTGDNLTGAGDGDDEVIIVDLPRIPAQIVKLVFVVNIYDCIARKQDFSQIENAFVRLVNAANNKELARYNLSGKE
YLGMTGMVLAEVYRHNDDWKLAAIGNGVNVNGLGELAGSYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-25 48
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-37 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-32 46
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-34 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-34 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-34 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-23 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-23 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-34 44
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-35 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Npun_R5983 YP_001869217.1 stress protein BAC0389 Protein 3e-35 45
Npun_R5983 YP_001869217.1 stress protein BAC0392 Protein 4e-24 45
Npun_R5983 YP_001869217.1 stress protein BAC0390 Protein 6e-33 42