Gene Information

Name : Npun_R5316 (Npun_R5316)
Accession : YP_001868580.1
Strain : Nostoc punctiforme PCC 73102
Genome accession: NC_010628
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6577139 - 6577822 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ava:Ava_3453 two component transcriptional regulator, winged helix family

DNA sequence :
GTGAACGTTCTATTTGTCGAAGATGAGGCGAAAATTGCTAACTTCGTCCGGGCTGGACTGAAGGAGCAGGGATTTGTTGT
AGACTACTGCGACAACGGTGATGAAGGATATCTGCGGGCATTAGAAAATGAATATGATGTTCTTATCCTCGACATTATGG
TGCCGGGAAAGGATGGACTATCAATCTTAAAACTCTTGCGGGGGCAAGGTCGGAATGCGCCGGTAATTTTGTTGACGGCT
CGGAATGAACTAGACGATCGCTTGGCAGGGCTAAATTTAGGAGCAGATGATTACATCGCTAAACCGTTTTTTGTAGAAGA
GTTAGCGGCTCGAATTCATGCCGTTGTTCGCCGGAGTGTGAGCAATCGCCAAAATATCCTTAGTGTTGGGCCGATCAGAC
TCGATCGCATCACCAGGGAAGTTACTTGCGATCGCCAGGCGATAGAACTCACCAGCCGCGAGTTCAATCTTCTAGAGTAT
CTGATGCGCTCTCCCGGACGGGTTTTCACCCGTACCCAAATTCTGGAGCATGTTTGGGGTTACGACTTTAACCCCAACAC
CAACGTCGTAGATGTTTGTATCCAGCGAATTCGTAAAAAAATTGACCCCATTGATGAACCAGTCTGGATTGAAAGCATTC
GAGGGGTTGGATATCGGTTTCGCAAACCAGAGTCTAGCTCATGA

Protein sequence :
MNVLFVEDEAKIANFVRAGLKEQGFVVDYCDNGDEGYLRALENEYDVLILDIMVPGKDGLSILKLLRGQGRNAPVILLTA
RNELDDRLAGLNLGADDYIAKPFFVEELAARIHAVVRRSVSNRQNILSVGPIRLDRITREVTCDRQAIELTSREFNLLEY
LMRSPGRVFTRTQILEHVWGYDFNPNTNVVDVCIQRIRKKIDPIDEPVWIESIRGVGYRFRKPESSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-38 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0125 Protein 5e-42 47
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0197 Protein 2e-43 45
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-34 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 44
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0083 Protein 3e-42 43
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0111 Protein 9e-45 43
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0347 Protein 5e-41 42
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0638 Protein 4e-36 42
Npun_R5316 YP_001868580.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 41
Npun_R5316 YP_001868580.1 two component transcriptional regulator BAC0308 Protein 4e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Npun_R5316 YP_001868580.1 two component transcriptional regulator VFG1386 Protein 3e-40 43
Npun_R5316 YP_001868580.1 two component transcriptional regulator VFG0596 Protein 3e-38 42
Npun_R5316 YP_001868580.1 two component transcriptional regulator VFG1389 Protein 7e-35 41