Gene Information

Name : Npun_R1688 (Npun_R1688)
Accession : YP_001865302.1
Strain : Nostoc punctiforme PCC 73102
Genome accession: NC_010628
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2070203 - 2070883 bp
Length : 681 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ava:Ava_0615 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACAGCACATATCCTTTTGGTGGAAGATGAAGTCAAACTAGCACGATTTGTCGAATTAGAGTTAAGTAGCGAAGGATA
CCAAGTAAGTGTAGCACATGATGGGATTGCTGGTCTCACCCTAGCGCGAGACTCATCACCAGATTTAGCGATTCTGGATT
GGATGTTACCAGGTTTAACAGGTTTAGAAATTTGTCGCCGTTTGCGAGCAACAGGTAGTACAGTACCAGTAATTTTACTG
ACGGCAAAAGATGAAGTGAGCGATCGCGTCGCCGGATTAGACGCGGGAGCCGATGATTATGTAGTTAAGCCCTTCAGCAT
AGAGGAACTACTAGCTAGAATTCGCGCCCATCTGCGCCGCACGCAAGAAACAGCCGAAGATTTGTTGCAATTTGAAGATT
TAAGCTTAAATCGTCGCACTCGTGAAGTTTTTCGGGAAAAACGAAGCATTGAGTTAACAGCAAAAGAGTTTGACTTATTA
GAATATCTCCTCTCACATCCTCGTCAGGTGTTTACTAGAGATCAAATTTTAGAGAAAGTTTGGGGTTATGATTTCATGGG
TGATTCTAATATTATTGAAGTATATATTCGTTATCTGCGACTCAAATTAGAAGAGAATAATGAAAAGCGTTTGATTCATA
CAGTCCGTGGTGTAGGCTATGCACTACGGGAGCAATCATAA

Protein sequence :
MTAHILLVEDEVKLARFVELELSSEGYQVSVAHDGIAGLTLARDSSPDLAILDWMLPGLTGLEICRRLRATGSTVPVILL
TAKDEVSDRVAGLDAGADDYVVKPFSIEELLARIRAHLRRTQETAEDLLQFEDLSLNRRTREVFREKRSIELTAKEFDLL
EYLLSHPRQVFTRDQILEKVWGYDFMGDSNIIEVYIRYLRLKLEENNEKRLIHTVRGVGYALREQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-36 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-35 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-45 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-49 51
Npun_R1688 YP_001865302.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-46 49
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0308 Protein 3e-41 46
Npun_R1688 YP_001865302.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-41 46
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0083 Protein 1e-40 45
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0197 Protein 6e-38 45
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0347 Protein 3e-39 44
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0125 Protein 8e-42 44
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0111 Protein 3e-40 44
Npun_R1688 YP_001865302.1 two component transcriptional regulator BAC0638 Protein 2e-34 44
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-43 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator CP000034.1.gene3671. Protein 9e-37 43
Npun_R1688 YP_001865302.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-37 42
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-32 42
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-32 42
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-32 42
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-37 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-43 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-40 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-18 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator CP004022.1.gene3215. Protein 6e-23 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-35 41
Npun_R1688 YP_001865302.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG1390 Protein 1e-55 54
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG0596 Protein 9e-37 46
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG1389 Protein 2e-41 46
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG1386 Protein 2e-46 44
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG1563 Protein 4e-36 42
Npun_R1688 YP_001865302.1 two component transcriptional regulator VFG1702 Protein 5e-36 42