Gene Information

Name : Bphy_6519 (Bphy_6519)
Accession : YP_001862593.1
Strain :
Genome accession: NC_010625
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1098151 - 1098837 bp
Length : 687 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B2069 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGAAGCTGCTCATCGTGGAGGATGAATTCAAGGTTGTCGACTATCTACGCCGTGGTCTGACGGAGCAGGGCTGGGTGGT
CGACGTCGCGCTCGACGGCGAAGAGGGGCTGCATCTCGCATCCGAGTTCGACTACGACATCATCGTGCTCGATGTGATGC
TGCCCAAGCGCGACGGCCTCAGCGTGCTCAAGGCGCTGCGCATGCGCAAGTCCACGCCCGTCATCATGCTGACTGCGCGC
GATCACGTGAACGACCGTGTGCGCGGCCTGCGCGAAGGGGCCGACGATTACCTGACCAAGCCGTTCTCGTTTCTCGAACT
GGTGGAGCGTTTGCACGCGCTCGCAAGGCGCACGCGCGTGCAGGAGTCGACGCTGATCTGCGTGGGCGATCTGTATGTCG
ATCTGATCGGAAGACGCGCGACGCGCGGCGGCGTGCGGCTCGATCTGACTGCGAAAGAGTTCCAGTTGCTGAGCGTGCTC
GCGCGCCGGCAGGGCGACATCCTGTCGAAGGCGATGATCACGGAACTGGTGTGGGATGTGAACTTCGACAGCCATACGAA
CGTCGTCGAAACGGCGATCAAGCGGCTGCGCGCGAAGCTCGACGGGCCGTTTCCGACCAAGCTGCTGCACACGATGCGCG
GCATGGGCTACGTGCTCGAAGTAAGAGAGGAAGCGGAGGCAACATGA

Protein sequence :
MKLLIVEDEFKVVDYLRRGLTEQGWVVDVALDGEEGLHLASEFDYDIIVLDVMLPKRDGLSVLKALRMRKSTPVIMLTAR
DHVNDRVRGLREGADDYLTKPFSFLELVERLHALARRTRVQESTLICVGDLYVDLIGRRATRGGVRLDLTAKEFQLLSVL
ARRQGDILSKAMITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPTKLLHTMRGMGYVLEVREEAEAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-47 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-46 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-56 56
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-51 55
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-57 54
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-52 51
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-44 51
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-51 50
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-47 48
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 3e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 4e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 3e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 5e-31 41
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 5e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-37 51
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-47 50
Bphy_6519 YP_001862593.1 two component heavy metal response transcriptional regulator VFG1390 Protein 4e-34 41