Gene Information

Name : Bphy_0469 (Bphy_0469)
Accession : YP_001856707.1
Strain :
Genome accession: NC_010622
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 532855 - 533517 bp
Length : 663 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_A0699 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGCATACTTCTCGTTGAAGACGACCGGATGATTGCCGAAGGCGTGCGCAAGGCGCTGCGCGGCGAAGGCTTCGCGGT
CGACTGGGTGCAGGACGGCGAGTCCGCGTTGAACGCGGCAGACGGTCAGCCGTACGATCTCGTGCTGCTCGATCTCGGTC
TGCCGAAGCGCGACGGCCTCGACGTGCTGCGCACGCTGCGCACGCGCGGTCATCAGTTGCCCGTGCTGATCGTGACCGCG
CGCGACGCCGTCGCGGATCGTGTAAAAGGACTCGACGCGGGCGCCGACGATTACCTCGTCAAACCGTTCGATCTCGACGA
ACTCGGCGCGCGGATGCGCGCGCTGATCCGCCGTCAGTCGGGGCGCAGCGAATCGACCATTCGCCACGGCAATCTCACGC
TCGATCCCGCTTCGCACCAGGTGACGCTCGACGGCGCGCCCGTCGCACTGTCCGCCCGCGAGTTCGCGCTGCTCGCCGCA
TTGCTCGCGCGGCCGGGCGCTGTGCTGTCGAAGAGTCAGCTCGAAGAAAAGATGTACGGCTGGGGCGAGGAGATCGGCAG
CAATACCGTCGAAGTCTATATTCACGCGCTTCGCAAGAAGCTTGGCGCGGAATTGATCCGCAACGTGCGCGGTCTCGGTT
ACATGATCGCGAAGGAAGCCTGA

Protein sequence : 
MRILLVEDDRMIAEGVRKALRGEGFAVDWVQDGESALNAADGQPYDLVLLDLGLPKRDGLDVLRTLRTRGHQLPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQSGRSESTIRHGNLTLDPASHQVTLDGAPVALSAREFALLAA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGAELIRNVRGLGYMIAKEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-40 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_0469 YP_001856707.1 two component transcriptional regulator BAC0487 Protein 5e-38 49
Bphy_0469 YP_001856707.1 two component transcriptional regulator BAC0197 Protein 3e-33 45
Bphy_0469 YP_001856707.1 two component transcriptional regulator BAC0083 Protein 2e-29 43
Bphy_0469 YP_001856707.1 two component transcriptional regulator NC_002516.2.879194.p Protein 9e-29 43
Bphy_0469 YP_001856707.1 two component transcriptional regulator BAC0638 Protein 5e-28 42
Bphy_0469 YP_001856707.1 two component transcriptional regulator BAC0347 Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphy_0469 YP_001856707.1 two component transcriptional regulator VFG0473 Protein 1e-38 48
Bphy_0469 YP_001856707.1 two component transcriptional regulator VFG1390 Protein 8e-34 45
Bphy_0469 YP_001856707.1 two component transcriptional regulator VFG0596 Protein 4e-28 43
Bphy_0469 YP_001856707.1 two component transcriptional regulator VFG1389 Protein 2e-25 43