Gene Information

Name : LAF_1298 (LAF_1298)
Accession : YP_001844114.1
Strain : Lactobacillus fermentum IFO 3956
Genome accession: NC_010610
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1482008 - 1482694 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence : 
ATGAGTCGGATTTTAATTATTGAAGATGAAGAAAACCTGGCACGCTTCGTTGAACTAGAACTGAAGCATGATGGTTACGA
AACGGATGTTGAACTGGACGGCCGCCAGGGGTTAGATGCGGCTTTAAACCAGGATTTTGACGTCATCTTATTGGATCTGA
TGTTACCGGAATTAAACGGACTGGAAGTGGCACGCCGGGTGCGGGAAGTCAAGGACACCCCAATTATCATCATGACCGCC
CGGGATTCGGTCATTGACCGGGTCTCTGGCCTGGACCACGGGGCCGATGATTACATCGTTAAGCCCTTTGCCATTGAAGA
ATTGTTGGCTCGGGTGCGGGCACTGTTACGGCGGATTTCAATTGAAGGCGACGCCAACAGCGTTCACCAAACGACGGTGA
CCTACAAAGACCTGACGATTGAAAAGGAAAACCGGGTGGTTCGGCGCGGCGACGAGGTGATCAACCTGACCAAGCGTGAA
TACGAACTGCTCTTGATCCTGATGGAAAACATTAACGTGGTCATGTCTCGTAAGGAACTCTTATCCAAGGTGTGGGGGTA
CGATTCCAAGGTGGAAACCAACGTGGTCGATGTCTACATTCGTTACCTGCGCAACAAGATTGACCGGCCGGGTGAAAAGA
GCTACATCCAAACCGTTCGTGGGACCGGTTACGTTATCCGCTCCTAG

Protein sequence : 
MSRILIIEDEENLARFVELELKHDGYETDVELDGRQGLDAALNQDFDVILLDLMLPELNGLEVARRVREVKDTPIIIMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARVRALLRRISIEGDANSVHQTTVTYKDLTIEKENRVVRRGDEVINLTKRE
YELLLILMENINVVMSRKELLSKVWGYDSKVETNVVDVYIRYLRNKIDRPGEKSYIQTVRGTGYVIRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LAF_1298 YP_001844114.1 two-component response regulator HE999704.1.gene1528. Protein 6e-75 72
LAF_1298 YP_001844114.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-50 56
LAF_1298 YP_001844114.1 two-component response regulator AE015929.1.gene1106. Protein 2e-45 51
LAF_1298 YP_001844114.1 two-component response regulator BAC0125 Protein 4e-33 44
LAF_1298 YP_001844114.1 two-component response regulator BAC0308 Protein 1e-33 42
LAF_1298 YP_001844114.1 two-component response regulator BAC0197 Protein 1e-30 42
LAF_1298 YP_001844114.1 two-component response regulator NC_012469.1.7686381. Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LAF_1298 YP_001844114.1 two-component response regulator VFG1390 Protein 6e-38 45
LAF_1298 YP_001844114.1 two-component response regulator VFG0596 Protein 9e-35 42
LAF_1298 YP_001844114.1 two-component response regulator VFG1389 Protein 5e-35 42