Gene Information

Name : Bind_2228 (Bind_2228)
Accession : YP_001833335.1
Strain : Beijerinckia indica ATCC 9039
Genome accession: NC_010581
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2554272 - 2554979 bp
Length : 708 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rpa:RPA1915 two-component transcriptional regulator FeuP, winged helix family

DNA sequence : 
TTGCGCATTCTGGTGGTCGAAGACGACAAGGACCTCAACCGCCAATTGACGGCGGCTCTCTCCCAGGCCGGCTATGCCGT
GGATCATGCCTTCGACGGCGAGGAAGGCTGGTTCCTGGGCGATACCGAACCTTACGACGCCGTGGTGCTCGACCTCGGTC
TACCGAAGAAGGACGGGCTTTCCGTCCTCAAGGAGTGGCGCAAAGCCGAGCGCTCAATGCCGGTCCTGATCCTGACGGCG
CGCGACCGCTGGAGCGACAAAGTCGAGGGCATAGACGCCGGCGCCGACGATTATGTCGCCAAGCCGTTTCATATGGAGGA
AGTGCTCGCCCGGTTGCGCGCCTTGCTGCGCCGCTCGGCCGGACGGGCCAGCGATGAACTGGTCTGCGGCCCGGTCAAGC
TCGATACACGCTCTGGCGCGGTGACAGTCGAAGATGTCCCGGTCAAGCTGACTTCACATGAATATCGTCTGCTCGCCTAT
ATGATGTTGCATGCCGGCCGGGTGATATCCCGTTCTGAAATCATCGAACATCTTTATGATCAGGATTTCGATCGCGATTC
CAATACGATCGAGGTTTTCGTCGGGCGCCTGCGCAAGAAACTGGGCTTCGACATTATCGAAACCTTGCGCGGCCTCGGTT
ATCGTGTGCCGGCCGCCGGCGAGACACTTCCGGCGAAATCCGCCAAGTCAGCAAAGTCCGACTCGTGA

Protein sequence : 
MRILVVEDDKDLNRQLTAALSQAGYAVDHAFDGEEGWFLGDTEPYDAVVLDLGLPKKDGLSVLKEWRKAERSMPVLILTA
RDRWSDKVEGIDAGADDYVAKPFHMEEVLARLRALLRRSAGRASDELVCGPVKLDTRSGAVTVEDVPVKLTSHEYRLLAY
MMLHAGRVISRSEIIEHLYDQDFDRDSNTIEVFVGRLRKKLGFDIIETLRGLGYRVPAAGETLPAKSAKSAKSDS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-28 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bind_2228 YP_001833335.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-38 49
Bind_2228 YP_001833335.1 two component transcriptional regulator CP000647.1.gene1136. Protein 2e-35 47
Bind_2228 YP_001833335.1 two component transcriptional regulator BAC0530 Protein 2e-35 47
Bind_2228 YP_001833335.1 two component transcriptional regulator CP001918.1.gene2526. Protein 3e-34 45
Bind_2228 YP_001833335.1 two component transcriptional regulator BAC0487 Protein 3e-29 44
Bind_2228 YP_001833335.1 two component transcriptional regulator NC_002695.1.913289.p Protein 8e-34 44
Bind_2228 YP_001833335.1 two component transcriptional regulator CP000034.1.gene2022. Protein 7e-35 44
Bind_2228 YP_001833335.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-35 44
Bind_2228 YP_001833335.1 two component transcriptional regulator CP004022.1.gene1005. Protein 6e-36 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bind_2228 YP_001833335.1 two component transcriptional regulator VFG0475 Protein 2e-35 44
Bind_2228 YP_001833335.1 two component transcriptional regulator VFG1390 Protein 3e-26 42
Bind_2228 YP_001833335.1 two component transcriptional regulator VFG0473 Protein 1e-25 41