|
Name : rpmG (XfasM23_0482) Accession : YP_001829203.1 Strain : Xylella fastidiosa M23 Genome accession: NC_010577 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 584140 - 584304 bp Length : 165 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCAGGCAAGCGCGACAAGATCCGCCTTATTTCTTCGGCTGATACTGGTCATTTTTATACGACTGACAAGAACAAAAA GAACACTCCTGGGAAGCTTGAGTTTAAAAAGTATGATCCTAGGGTGCGTAGGCATGTGATCTACAAGGAAGGCAAGATTA AGTAA Protein sequence : MAGKRDKIRLISSADTGHFYTTDKNKKNTPGKLEFKKYDPRVRRHVIYKEGKIK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 2e-06 | 44 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 2e-06 | 44 |
