Gene Information

Name : SGR_6479 (SGR_6479)
Accession : YP_001827991.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Resistance
Product : TerD-family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7742115 - 7742690 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGGCGTGAGCCTCGCCAAGGGCGGAAACGTCTCGCTGAGCAAGGAGGCCCCCGGGCTGACCGCGATCCTCGTCGGTCT
GGGCTGGGACGTCCGCACGACCACCGGCGCCGACTACGACCTGGACGCGAGCGCGCTGCTCTGCGACGAGGCGGGCAAGG
TGCTGTCCAACGAGCACTTCGTCTTCTACAACAACCTCAAGAGCCCCGACGGGTCGGTCGAGCACACCGGGGACAACCTG
ACCGGCGAGGGCGAGGGCGACGACGAGATCGTCAAGGTCGACCTCGCCTCGGTGCCCGCGACCGTCGCCAGGATCGTGTT
CCCGGTCTCCATCCACGACGCGGAGAGCCGGGGGCAGAGCTTCGGCCAGGTGCGCAACGCCTACATCCGGGTGGTGAACC
AGGCGGGCGGCGCGGAGATCGCCCGCTACGACCTGAGCGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGGCAGGGTTACGCATCCGGCCTCAGCGGCATCGTCGCCGACTT
CGGCGTCGGTCTCTGA

Protein sequence :
MGVSLAKGGNVSLSKEAPGLTAILVGLGWDVRTTTGADYDLDASALLCDEAGKVLSNEHFVFYNNLKSPDGSVEHTGDNL
TGEGEGDDEIVKVDLASVPATVARIVFPVSIHDAESRGQSFGQVRNAYIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLSGIVADFGVGL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-62 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-58 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-57 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-27 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-27 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_6479 YP_001827991.1 TerD-family protein BAC0390 Protein 1e-62 65
SGR_6479 YP_001827991.1 TerD-family protein BAC0389 Protein 1e-59 65
SGR_6479 YP_001827991.1 TerD-family protein BAC0392 Protein 1e-26 42