Gene Information

Name : rpmG (SGR_546)
Accession : YP_001822058.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L33
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0267
EC number : -
Position : 630154 - 630318 bp
Length : 165 bp
Strand : +
Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th

DNA sequence :
ATGGCTCGCAACGAAGTACGCCCGGTCATCAAGCTCCGCTCCACCGCGGGGACCGGTTACACCTATGTCACCCGCAAGAA
CCGGCGGAACGACCCCGACCGGATGGTGCTGCGCAAGTACGACCCGGTCGCCCGCCGCCACGTCGACTTCCGCGAGGAGC
GCTGA

Protein sequence :
MARNEVRPVIKLRSTAGTGYTYVTRKNRRNDPDRMVLRKYDPVARRHVDFREER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0106 AAM75309.1 EF0106 Not tested Not named Protein 5e-04 41
rpmG NP_814353.1 50S ribosomal protein L33 Not tested Not named Protein 7e-04 41