Gene Information

Name : SGR_5134 (SGR_5134)
Accession : YP_001826646.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Resistance
Product : TerD-family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 6050285 - 6050860 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAACGTCTCCCTCTCCAAGGTCGCACCCAACCTCACCCAGGTGCTGGTCGGGCT
CGGCTGGGACGCGCGCTCCACCACGGGAGCCGCCTTCGACCTCGACGCCAGCGCACTGCTGTGCCAGTCGGGCCGCGTGC
TCGGTGACGAGTGGTTCATCTTCTACAACAACCTCATGAGCCCCGACGGCTCCGTCGAGCACACCGGCGACAACCTCACC
GGGGAGGGCGACGGCGACGACGAGTCCGTCATCGTCCGCCTCGACCAGGTTCCCGCCCACTGCGACAAGATCGTCTTCCC
GGTCTCGATCCATGACGCGGACAACCGGGGCCAGGCCTTCGGTCAGGTCAGCAACGCCTTCATCCGGGTGGTCAACCAGG
CCGACGGCCAGGAACTGGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCGATGATCTTCGGCGAGCTCTAC
CGGTACAACGGCGAGTGGAAGTTCCGTGCCGTCGGCCAGGGGTACGCGTCCGGCCTGCGGGGCATCGCTCTAGACTTCGG
CGTCAACGTTTCATAG

Protein sequence :
MGVTLAKGGNVSLSKVAPNLTQVLVGLGWDARSTTGAAFDLDASALLCQSGRVLGDEWFIFYNNLMSPDGSVEHTGDNLT
GEGDGDDESVIVRLDQVPAHCDKIVFPVSIHDADNRGQAFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGELY
RYNGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 70
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-58 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-59 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-52 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-52 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-52 62
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-25 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_5134 YP_001826646.1 TerD-family protein BAC0389 Protein 5e-58 69
SGR_5134 YP_001826646.1 TerD-family protein BAC0390 Protein 2e-56 63
SGR_5134 YP_001826646.1 TerD-family protein BAC0392 Protein 8e-25 43