Gene Information

Name : SGR_341 (SGR_341)
Accession : YP_001821853.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Resistance
Product : TerD-family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 368237 - 368812 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGTGTGACCCTGGCCAAGGGCGGCAACGTCTCCCTGTCGAAGGAGGCCCCCGGCCTGACCGCCGTGACGGTCGGGCT
CGGCTGGGACGTACGGACCACGACCGGAGCCGATCACGACCTGGACGCCAGCGCGCTGCTGTGCTCCGAGGCGGGCAAGG
TCCTCTCCGACGCCCACTTCGTCTTCTACAACAACCTCAACAGCCCCGACGGTTCCGTCCGCCACACCGGTGACAACCTG
ACGGGTGAGGGCGAGGGAGACGACGAGTCGGTCGAGGTCGACCTGGCGTCGGTCCCCGCCGAGATCGCGAAGATCGTGTT
CCCCGTGTCCATCCACGACGCCCAGAGCCGGGGCCAGAGCTTCGGTCAGGTGCGCAACGCGTTCATCCGCGTGGTGAACC
GGGCCAACGGCGTCGAGCTCGCCCGGTACGACCTGAGCGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGGCACGGCGCCGAGTGGAAGTTCCGGGCCGTCGGCCAGGGTTACGCCTCCGGGCTGGCGGGCATCGCCTCGGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MGVTLAKGGNVSLSKEAPGLTAVTVGLGWDVRTTTGADHDLDASALLCSEAGKVLSDAHFVFYNNLNSPDGSVRHTGDNL
TGEGEGDDESVEVDLASVPAEIAKIVFPVSIHDAQSRGQSFGQVRNAFIRVVNRANGVELARYDLSEDASTETAMVFGEL
YRHGAEWKFRAVGQGYASGLAGIASDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-54 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-52 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-52 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-52 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-24 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-19 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_341 YP_001821853.1 TerD-family protein BAC0389 Protein 2e-53 67
SGR_341 YP_001821853.1 TerD-family protein BAC0390 Protein 5e-56 66
SGR_341 YP_001821853.1 TerD-family protein BAC0392 Protein 9e-20 41