Gene Information

Name : SGR_2135 (SGR_2135)
Accession : YP_001823647.1
Strain : Streptomyces griseus NBRC 13350
Genome accession: NC_010572
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2532691 - 2533353 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGCCTCGCGGTGTCCCTGGCCAGGGGGCTGACCGCCGAGGGTTTCGCCGT
GGATGTCGTGCACGACGGCCTGGAGGGGCTGCACCGGGCGAGCGAGGGCGCCTACGACCTGGTGATCCTCGACATCATGC
TGCCCGGCATGAACGGCTACCGCGTCTGCTCGAACCTGCGCGCGGCCGGGCACGAGGTGCCGATCCTCATGCTGACCGCC
AAGGACGGCGAGTACGACGAGGCCGAGGGCCTGGACACCGGCGCCGACGACTACCTGACCAAACCCTTCAGCTACGTCGT
CCTCGTCGCCCGGGTCCGCGCCCTGCTGCGCCGCCGGGGGGCCGGCACCGCCGCGCCCGTCCTGACCGTCGGCGCCCTGC
GCGTCGACACCGCCGCCCGCCGGGTGATCCGCGGCGAGGACGAGATCACGCTCACCGCCAAGGAGTTCGCGGTGCTGGAG
CAGCTCGCCCTGCGCGCGGGCCAGGTCGTCAGCAAGGCGGAGATCCTGGAGCACGTCTGGGACTTCGCGTACGACGGCGA
TCCGAACATCGTCGAGGTCTACATCTCCACCCTGCGCCGCAAGCTCGGCGCGAGTGCCATCCGCACCGTGCGCGGCGCGG
GCTACCGGCTGGAGGCGAAGTGA

Protein sequence :
MRLLIVEDEKRLAVSLARGLTAEGFAVDVVHDGLEGLHRASEGAYDLVILDIMLPGMNGYRVCSNLRAAGHEVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVRALLRRRGAGTAAPVLTVGALRVDTAARRVIRGEDEITLTAKEFAVLE
QLALRAGQVVSKAEILEHVWDFAYDGDPNIVEVYISTLRRKLGASAIRTVRGAGYRLEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_2135 YP_001823647.1 two-component system response regulator BAC0083 Protein 9e-39 48
SGR_2135 YP_001823647.1 two-component system response regulator BAC0111 Protein 4e-38 47
SGR_2135 YP_001823647.1 two-component system response regulator BAC0638 Protein 8e-34 47
SGR_2135 YP_001823647.1 two-component system response regulator BAC0125 Protein 2e-36 44
SGR_2135 YP_001823647.1 two-component system response regulator BAC0308 Protein 6e-37 44
SGR_2135 YP_001823647.1 two-component system response regulator BAC0347 Protein 5e-32 44
SGR_2135 YP_001823647.1 two-component system response regulator BAC0197 Protein 8e-36 44
SGR_2135 YP_001823647.1 two-component system response regulator U82965.2.orf14.gene. Protein 7e-25 44
SGR_2135 YP_001823647.1 two-component system response regulator Y16952.3.orf35.gene. Protein 6e-25 43
SGR_2135 YP_001823647.1 two-component system response regulator NC_002516.2.879194.p Protein 6e-24 42
SGR_2135 YP_001823647.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-28 41
SGR_2135 YP_001823647.1 two-component system response regulator BAC0487 Protein 2e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGR_2135 YP_001823647.1 two-component system response regulator VFG0596 Protein 6e-34 44
SGR_2135 YP_001823647.1 two-component system response regulator VFG1390 Protein 6e-37 44
SGR_2135 YP_001823647.1 two-component system response regulator VFG1386 Protein 3e-31 43
SGR_2135 YP_001823647.1 two-component system response regulator VFG1389 Protein 2e-30 42