Gene Information

Name : BamMC406_5744 (BamMC406_5744)
Accession : YP_001815739.1
Strain :
Genome accession: NC_010557
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 267737 - 268414 bp
Length : 678 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_5988 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCCTGATAGTCGAAGACGAACCGAAGACGGCCGCGTACTTGAAGAAAGGCCTCGAGGAATCCGGCTTCAGCAT
CGATCTTGCGAAGGACGGCGCGGAAGGGCTGATGCTCGCGCAGGAAGAGAACTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGTGCTCGACGGGTGGGGCGTGCTCAAGCGCCTGCGCGACACCCACACGACGCCCGTGCTGTTCCTGACCGCGCGC
GACGATGTGCAGGACCGCGTGCACGGTCTCGAGCTGGGCGCCGATGATTACCTCGTGAAGCCGTTCGCGTTCGTCGAACT
GCTCGCGCGCATCCGCACGCTTGCGCGCCGCGGGCCACCGCGCGAGACCGAGCGCATCGTGGTCGGCGACCTGGAAATCG
ACGTCGTGCGCCGCCGCGTGAAGCGCGGCACGGTGCGGATCGACCTGACGCCACGCGAGTTCTCGCTGCTGCAGTTGCTC
GCGCGCCGGCAAGGCGAAGTGCTGAGCCGCACGCAGATCGCGTCGTATGTCTGGGACATGAACTTCGACAGCGACACCAA
CGTCGTCGAAGTCGCCATCCGGCGACTGCGCGCGAAGATCGACGATGCGTTTCCGGTCAAGCTGATCCATACGGTGCGCG
GCGTAGGCTACGTGCTCGAACCGAAGGACGGTGCATGA

Protein sequence :
MRILIVEDEPKTAAYLKKGLEESGFSIDLAKDGAEGLMLAQEENYDVIVLDVMLPVLDGWGVLKRLRDTHTTPVLFLTAR
DDVQDRVHGLELGADDYLVKPFAFVELLARIRTLARRGPPRETERIVVGDLEIDVVRRRVKRGTVRIDLTPREFSLLQLL
ARRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIHTVRGVGYVLEPKDGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-54 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-68 68
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0197 Protein 8e-67 65
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-63 62
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-54 60
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-60 59
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-58 58
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator BAC0347 Protein 6e-53 55
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 5e-28 45
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-38 44
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 6e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 5e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 7e-33 43
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 6e-31 42
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 5e-32 41
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 3e-33 41
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator U82965.2.orf14.gene. Protein 1e-23 41
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator VFG0596 Protein 8e-56 55
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-37 50
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-38 47
BamMC406_5744 YP_001815739.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-36 44