Gene Information

Name : Exig_0644 (Exig_0644)
Accession : YP_001813142.1
Strain : Exiguobacterium sibiricum 255-15
Genome accession: NC_010556
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 680874 - 681560 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: btl:BALH_1162 response regulator

DNA sequence :
ATGCCAGAACAATCCTTTAAAATACTTGTCGTAGATGACGAAGCACAAATGCGTGATCTGCTTGTCTCAAATCTTCAAAA
AGAAAACTATCAGACGACGACGGCTTCGAACGGTCAAGAAGCACTTGATTTAATGCAACGTGATGCCTTCCATCTCGTTT
TGCTGGATGTCATGATGCCGGAAATGGACGGTTTGACGGCTTGCATGCGAATCCGTGAATTCTCGAACGTCCCGATCATC
ATGCTAACGGCCCGTTCGGACGAACTCGACCGGATTCACGGTCTGAAAATTGGGGCCGATGACTACATCACGAAACCGTT
CAGCCCTCGTGAACTGTTGGCCCGCATCGAAGCGACGTTGCGACGTTCCCATCGTTTTACAGTCGATCAATCGGCGACGT
TGACGATCGGCAAACTGGAGCTTGATACAGAAAGCCGCAGTGTCCACGTCAGCGGAAAACCAATCAGTTTAACGCGGAAG
GAATTTGACTTACTCCATTTGTTTGTCCAAAACAACGATAAAGTCTTTTCACGCGAACAGTTGCTCGATCAAATTTGGGG
CGCCGACTACATCGGAAATCTGCGGACTGTCGATACCCACATCAAAACACTTCGTCTGAAACTCGGTGAAGCCGGCGGCT
CGATCCAAACGGTCTGGGGCATCGGATATAAATTCGAGGAAGTATGA

Protein sequence :
MPEQSFKILVVDDEAQMRDLLVSNLQKENYQTTTASNGQEALDLMQRDAFHLVLLDVMMPEMDGLTACMRIREFSNVPII
MLTARSDELDRIHGLKIGADDYITKPFSPRELLARIEATLRRSHRFTVDQSATLTIGKLELDTESRSVHVSGKPISLTRK
EFDLLHLFVQNNDKVFSREQLLDQIWGADYIGNLRTVDTHIKTLRLKLGEAGGSIQTVWGIGYKFEEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_0644 YP_001813142.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-42 46
Exig_0644 YP_001813142.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-49 45
Exig_0644 YP_001813142.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-44 45
Exig_0644 YP_001813142.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-48 45
Exig_0644 YP_001813142.1 two component transcriptional regulator HE999704.1.gene1202. Protein 3e-37 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-41 43
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_012469.1.7686381. Protein 4e-41 42
Exig_0644 YP_001813142.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator BAC0039 Protein 3e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 42
Exig_0644 YP_001813142.1 two component transcriptional regulator BAC0596 Protein 8e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator CP001138.1.gene2239. Protein 8e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-35 42
Exig_0644 YP_001813142.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-25 42
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-40 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-40 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-40 41
Exig_0644 YP_001813142.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-41 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-41 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-38 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP000647.1.gene2531. Protein 7e-39 41
Exig_0644 YP_001813142.1 two component transcriptional regulator NC_002695.1.915041.p Protein 7e-29 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP000647.1.gene4257. Protein 4e-29 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP000034.1.gene3834. Protein 7e-29 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP001138.1.gene4273. Protein 6e-29 41
Exig_0644 YP_001813142.1 two component transcriptional regulator BAC0533 Protein 4e-29 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-43 41
Exig_0644 YP_001813142.1 two component transcriptional regulator CP004022.1.gene1676. Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_0644 YP_001813142.1 two component transcriptional regulator VFG1563 Protein 1e-38 42
Exig_0644 YP_001813142.1 two component transcriptional regulator VFG1702 Protein 1e-38 42