Gene Information

Name : Exig_2843 (Exig_2843)
Accession : YP_001815306.1
Strain : Exiguobacterium sibiricum 255-15
Genome accession: NC_010556
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2827542 - 2828225 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: oih:OB0594 two-component response regulator

DNA sequence :
ATGGCACCGACCATCTTAATCGTCGAGGACGATTCGAAAATCGCCCGCCTACTTGAACTGGAATTAAACCACGCTGGATA
CGCGACGCAGGTCGCCTTCAACGGTAAAGATGGCTTAGTAGCTGCTGAGAACGACATCGATCTCGTCTTACTTGACGTGA
TGATGCCGGAGCTCAGCGGCTTCGAGGTGCTTCGGCGGCTTCGCGGAAAAGGTAATCCGGTTCCCGTCATCTTATTGACG
GCACGGGGCGAAGTGTATGACAAGGTTGCCGGTCTTGATCTCGGAGCCAATGATTATGTGACGAAACCGTTTGAAATCGA
AGAATTGTTGGCCCGAATCCGGGGCTTACTCCGCTTGACGACACAGGCTGCGGTCGAAACCAATCAACTTCATTATGCCG
ATGTCTTACTGGATTTAGACCGGCATGAAGCATTTCGTAACGACGTCCCGCTTGATTTGACACCACGCGAATTTGATTTG
TTGTCTTATCTGATGGAAAACAAGGAGCACGTTTTGACCCGTGAGCAAATCCTCAATCGGGTTTGGGGTTATGATTATTT
CGGAGAAACGAATATCGTCGATGTCTACATCCGGTATTTACGCAAAAAAATGGACCGTAGCCAGTCTCCCCTCATTCAGA
CCGTTCGTGGCATCGGTTATGTCTTAAGGGAGGAGAAAGGATGA

Protein sequence :
MAPTILIVEDDSKIARLLELELNHAGYATQVAFNGKDGLVAAENDIDLVLLDVMMPELSGFEVLRRLRGKGNPVPVILLT
ARGEVYDKVAGLDLGANDYVTKPFEIEELLARIRGLLRLTTQAAVETNQLHYADVLLDLDRHEAFRNDVPLDLTPREFDL
LSYLMENKEHVLTREQILNRVWGYDYFGETNIVDVYIRYLRKKMDRSQSPLIQTVRGIGYVLREEKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_2843 YP_001815306.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-43 51
Exig_2843 YP_001815306.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-42 49
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-47 48
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0197 Protein 6e-39 46
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0125 Protein 3e-40 44
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0083 Protein 3e-41 43
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0308 Protein 4e-38 43
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0638 Protein 9e-35 43
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0347 Protein 7e-35 42
Exig_2843 YP_001815306.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-39 42
Exig_2843 YP_001815306.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-44 41
Exig_2843 YP_001815306.1 two component transcriptional regulator BAC0111 Protein 6e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Exig_2843 YP_001815306.1 two component transcriptional regulator VFG1390 Protein 9e-45 47
Exig_2843 YP_001815306.1 two component transcriptional regulator VFG1389 Protein 1e-40 46
Exig_2843 YP_001815306.1 two component transcriptional regulator VFG1386 Protein 8e-49 45
Exig_2843 YP_001815306.1 two component transcriptional regulator VFG0596 Protein 5e-35 43