Gene Information

Name : PMI2710 (PMI2710)
Accession : YP_002152411.1
Strain : Proteus mirabilis HI4320
Genome accession: NC_010554
Putative virulence/resistance : Resistance
Product : multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2961494 - 2961820 bp
Length : 327 bp
Strand : -
Note : Also similar to PMI1514 (43.6 38d), PMI2711 (43.9 id) and PMI3584 (32.2 38d)

DNA sequence : 
ATGTTTACCGGATTCTTATGGCTGGCGCTGTCTATTGGTTCTGAAATCACAGGCACCTCAATGATTAAAAAGACCAATGG
CTTTAGTAAATTAGCCCCCTCTGTTTTAGTGATTGCCGCTTACTGTATTTGCTATTTCGCCTTAACACGTGCAATGGGCT
ATATCCCTGTTGGTGTGGCATATTCCTTGTGGTGTGGATTTGGTATTGTTGGGGTAACATTAGTTGCCATGATTTTATAT
AAACAAAAACCCGATCTACCCGCTATATTCTCAATGGCATTGATTATCTCTGGTGGGATAATTATGAATACCTTTTCAAC
GATGTAA

Protein sequence : 
MFTGFLWLALSIGSEITGTSMIKKTNGFSKLAPSVLVIAAYCICYFALTRAMGYIPVGVAYSLWCGFGIVGVTLVAMILY
KQKPDLPAIFSMALIISGGIIMNTFSTM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 85
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 2e-16 46
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 4e-13 43
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 4e-13 43
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-13 43
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 4e-13 43
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 4e-13 43
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 4e-13 43
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 4e-13 43
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 4e-13 43
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 6e-13 43
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 4e-13 43
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 43
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-13 43
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 43
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 6e-13 43
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 43
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 6e-13 43
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 4e-13 43
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 4e-13 43
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 4e-13 43
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 6e-13 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PMI2710 YP_002152411.1 multidrug resistance protein BAC0324 Protein 3e-14 44
PMI2710 YP_002152411.1 multidrug resistance protein CP004022.1.gene1549. Protein 2e-18 44
PMI2710 YP_002152411.1 multidrug resistance protein BAC0323 Protein 2e-13 43
PMI2710 YP_002152411.1 multidrug resistance protein BAC0322 Protein 1e-14 42
PMI2710 YP_002152411.1 multidrug resistance protein BAC0150 Protein 1e-14 42
PMI2710 YP_002152411.1 multidrug resistance protein CP001138.1.gene1489. Protein 4e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PMI2710 YP_002152411.1 multidrug resistance protein VFG1586 Protein 6e-37 85
PMI2710 YP_002152411.1 multidrug resistance protein VFG1587 Protein 9e-17 46