Gene Information

Name : insN (PMI2610)
Accession : YP_002152325.1
Strain : Proteus mirabilis HI4320
Genome accession: NC_010554
Putative virulence/resistance : Unknown
Product : transposase for insertion sequence element IS911
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2857976 - 2858278 bp
Length : 303 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAACGAAATTTCAGTGCAGAATTCAGACGTGAATCCGCTCAGTTAGTGGTGGATCAACACTATACGGTTGCAGA
TGCCGCAAATGCCATGGATGTCGGACTTTCCACTATGACCCGGTGGGTAAAGCAGCTACGAGATGAACGTGCCGGCAAAA
CACCTAAAGCCTCCCCTATCACGCCGGAGCAAATTGAGATACGTGAGCTGAAGAAAAAACTTCAACGTATTGAAATGGAA
AATGAAATATTAAAAAAGGCTACTGCGCTCTTGATGTCAGATTCCCTGAACAACTCTCGATAA

Protein sequence :
MKKRNFSAEFRRESAQLVVDQHYTVADAANAMDVGLSTMTRWVKQLRDERAGKTPKASPITPEQIEIRELKKKLQRIEME
NEILKKATALLMSDSLNNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-41 100
api80 CAF28554.1 putative transposase Not tested YAPI Protein 7e-35 95
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-39 93
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-39 93
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-31 77
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-31 77
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 77
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-31 77
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 77
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 77
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 77
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-31 77
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-28 66
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-24 62
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 2e-24 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-23 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-23 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-23 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-23 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-21 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 9e-20 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 VFG1485 Protein 4e-40 93
insN YP_002152325.1 transposase for insertion sequence element IS911 VFG1123 Protein 2e-31 77
insN YP_002152325.1 transposase for insertion sequence element IS911 VFG1553 Protein 1e-28 66
insN YP_002152325.1 transposase for insertion sequence element IS911 VFG0784 Protein 2e-23 60