Gene Information

Name : BamMC406_4186 (BamMC406_4186)
Accession : YP_001810866.1
Strain :
Genome accession: NC_010552
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1233734 - 1234429 bp
Length : 696 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_3708 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence : 
ATGAAAGTGCTGATCGTCGAAGACGAACCGAAAGTCGTCGAATACCTGAAGAGCGGCCTGACCGAGGAAGGCTGGGTCGT
CGATACCGCGCTCGACGGCGAGGACGGCGCGTGGAAGGCCATCGAATTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAACTCGACGGCTTCGGCGTGCTGCGCGCGTTGCGCGCGCAGAAGCAGACGCCCGTGATCATGCTGACCGCGCGC
GACCGCGTCGACGACCGCGTGCGCGGGCTGCGCGGCGGCGCCGACGACTACCTGACCAAGCCCTTCTCGTTCCTCGAGCT
GATCGAGCGGCTGCGCGCGCTCACGCGCCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGCGTCG
ACCTGATCGGTCGCCGCGCGACCCGCGACGGCACGCGCCTCGACCTCACCGCGCAGGAATTCCAGTTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGAGGTGCTGTCGAAAACGACGATCGCCGAGCTCGTATGGGACGTGAACTTCGACAGCAACGCGAA
CGTCGTCGAGACGGCGATCAAGCGCCTGCGCGCGAAGCTCGACGGTCCGTTCGCGGAGAAACTGCTGCACACGATCCGCG
GCATGGGCTATGTGCTCGAGGCGCGCGAGGAAGGCGACGCGGAGCGGCACGCATGA

Protein sequence : 
MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAIEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVL
ARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFAEKLLHTIRGMGYVLEAREEGDAERHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-41 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-40 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-48 59
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0125 Protein 8e-53 58
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-47 54
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-39 54
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-45 51
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0308 Protein 1e-45 51
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-40 48
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator CP000675.2.gene1535. Protein 4e-30 41
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator VFG0596 Protein 9e-42 53
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator VFG1389 Protein 4e-31 48
BamMC406_4186 YP_001810866.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-26 42