Gene Information

Name : BamMC406_2538 (BamMC406_2538)
Accession : YP_001809231.1
Strain :
Genome accession: NC_010551
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2818781 - 2819413 bp
Length : 633 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bam:Bamb_2665 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGATTGCCGAAGGCGTACGCAAGGCATTGCGCGCCGACGGCTTCGCGGTCGACTGGGTGCAGGACGGCGACGCCGCGCT
CACGGCGCTCGGCGGCGAGGCGTACGACCTGCTGCTGCTCGATCTCGGCCTGCCGAAGCGCGACGGCATCGACGTGCTGC
GCACGCTGCGCGCGCGCGGGCAGTCGCTGCCGGTGCTGATCGTCACCGCGCGCGATGCGGTCGCCGATCGCGTGAAGGGG
CTCGACGCGGGCGCCGACGACTACCTCGTCAAGCCGTTCGACCTCGACGAACTGGGCGCGCGGATGCGCGCGCTGATCCG
CCGCCAGGCCGGGCGCAGCGAATCGCTGATCCGCCACGGCGCGCTGACGCTCGATCCCGCGTCGCATCAGGTGACGCTCG
ACGGCGCGCCCGTCGCGCTGTCCGCGCGCGAGTTCGCGCTGCTCCAGGCGCTGCTGGCGCGGCCCGGCGCGGTGCTGTCG
AAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGAGGAGATCGGCAGCAACACGGTCGAGGTCTACATCCACGCGCT
GCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACGTGCGCGGGCTCGGCTACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MIAEGVRKALRADGFAVDWVQDGDAALTALGGEAYDLLLLDLGLPKRDGIDVLRTLRARGQSLPVLIVTARDAVADRVKG
LDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALLQALLARPGAVLS
KSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-36 52
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-26 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_2538 YP_001809231.1 two component transcriptional regulator BAC0487 Protein 1e-35 50
BamMC406_2538 YP_001809231.1 two component transcriptional regulator BAC0083 Protein 2e-30 46
BamMC406_2538 YP_001809231.1 two component transcriptional regulator BAC0197 Protein 1e-31 45
BamMC406_2538 YP_001809231.1 two component transcriptional regulator BAC0638 Protein 1e-22 44
BamMC406_2538 YP_001809231.1 two component transcriptional regulator NC_002516.2.879194.p Protein 2e-27 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BamMC406_2538 YP_001809231.1 two component transcriptional regulator VFG0473 Protein 3e-36 49
BamMC406_2538 YP_001809231.1 two component transcriptional regulator VFG1390 Protein 2e-34 44
BamMC406_2538 YP_001809231.1 two component transcriptional regulator VFG0596 Protein 2e-26 43
BamMC406_2538 YP_001809231.1 two component transcriptional regulator VFG1389 Protein 1e-29 42