Gene Information

Name : czcR (RALTA_B1458)
Accession : YP_002008109.1
Strain :
Genome accession: NC_010530
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1570771 - 1571460 bp
Length : 690 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 9044283; Product type r : regulator

DNA sequence :
ATGCGTATCCTGATTGTCGAGGACGAACCCAAGGCAGGCGACTACCTGCACAAGGGCCTGACCGAATCCGGCTTCGTGGT
GGACCTGGCGCGCGACGGCGCGGACGGCCTGGCCCACGCGCGCGAGCATCCTTATGACCTGATCGTGCTGGACGTGATGC
TGCCCGGGCTGGACGGCTGGGAGGTGCTGCGCGAGCTGCGCCGCGAGCGCGACACGCCGGTGCTGTTCCTGACCGCGCGC
GACGAGCTGTCGGACCGCCTCAAGGGCCTTGAGCTCGGCGCGGACGACTACATGGTCAAGCCCTTTGCCTTTGCCGAGCT
GGTGCTGCGCATCCGCACCATCCTGCGCCGCGGCCCGCTGCGCGAGAGCGAGTTCATCGAAGTGGCCGACCTGCAGATCG
ACGCCATCCGCCGCCGCGTGGTGCGCGCCGGCCAGAAGATCGACCTGACCTCCAAGGAGTTTGCGCTGCTGTACCTGCTG
GCGCGCCGGCGCGGCGAGGTGCTGTCGCGCTCGCTGATCGCTTCGCAGGTGTGGGATGTCAATTTCGACAGCAACACCAA
TGTGGTCGACGTGTCGATCCGGCGCCTGCGCGCCAAGGTCGACGACCCGTTCCCGCGCAAGCTGATCCATACGCGCCGCG
GCATGGGCTATGTGCTGGACGACGGCGATGACCGGGTGCAAGACGCATGA

Protein sequence :
MRILIVEDEPKAGDYLHKGLTESGFVVDLARDGADGLAHAREHPYDLIVLDVMLPGLDGWEVLRELRRERDTPVLFLTAR
DELSDRLKGLELGADDYMVKPFAFAELVLRIRTILRRGPLRESEFIEVADLQIDAIRRRVVRAGQKIDLTSKEFALLYLL
ARRRGEVLSRSLIASQVWDVNFDSNTNVVDVSIRRLRAKVDDPFPRKLIHTRRGMGYVLDDGDDRVQDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-59 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-58 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0197 Protein 4e-70 66
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0125 Protein 3e-71 65
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0638 Protein 4e-61 64
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0083 Protein 4e-67 62
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0308 Protein 9e-64 59
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0111 Protein 7e-63 58
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0347 Protein 8e-55 55
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002758.1121390.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_010079.5776364.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002952.2859858.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_007622.3794948.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_003923.1003417.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_013450.8614146.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002951.3238224.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_007793.3914065.p0 Protein 2e-43 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba AE015929.1.gene1106. Protein 1e-37 44
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba HE999704.1.gene1528. Protein 3e-28 42
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002952.2859905.p0 Protein 4e-34 42
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba HE999704.1.gene2815. Protein 6e-32 42
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba AE000516.2.gene3505. Protein 9e-32 42
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_009782.5559369.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002951.3237708.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002758.1121668.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_009641.5332272.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_013450.8614421.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_007793.3914279.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_007622.3794472.p0 Protein 3e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba NC_002745.1124361.p0 Protein 4e-34 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba BAC0596 Protein 6e-26 41
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba CP001138.1.gene2239. Protein 6e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba VFG0596 Protein 2e-59 56
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba VFG1389 Protein 1e-34 47
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba VFG1390 Protein 6e-37 44
czcR YP_002008109.1 response regulator in two-component regulatory system, regulation of heavy metal resistance operon czccba VFG1386 Protein 6e-37 44