Gene Information

Name : RALTA_A3122 (RALTA_A3122)
Accession : YP_002007103.1
Strain :
Genome accession: NC_010528
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3302036 - 3302470 bp
Length : 435 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator

DNA sequence : 
ATGAATATCGGCGAAGCGGCACAGGCCTCGGGCGTATCGGCCAAGATGATCCGCCACTATGAATCGATCGGGCTGGTGGC
GGCGCCGCCGCGCACCGATGGCGGCTACCGCCGCTATGACGAACGCGCGGTGCATACCTTGCGCTTCGTGCGGCGTGCCC
GTAATCTGGGATTCTCGCTCGACGAGATCCGCGACCTGCTGTCACTGTGGCACGACCGGGGCCGCGCCAGCGCCGACGTC
AAGGCGCTGACGCTGCGGCATGTGGCCGACCTGGAGCAGCGCATCGCCGAACTGGCGGCGATGCGCGACACGCTGCGCGA
GCTGGCGCAGCACTGCAGCGGCGACGACCGACCGGACTGCCCGATCCTGGCCGACATGGCGCAGCCGGACGCGCCCGCCC
GGCCGGACTGCCACACCGCCAAAGCCATGCCCTGA

Protein sequence : 
MNIGEAAQASGVSAKMIRHYESIGLVAAPPRTDGGYRRYDERAVHTLRFVRRARNLGFSLDEIRDLLSLWHDRGRASADV
KALTLRHVADLEQRIAELAAMRDTLRELAQHCSGDDRPDCPILADMAQPDAPARPDCHTAKAMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RALTA_A3122 YP_002007103.1 MerR family transcriptional regulator BAC0190 Protein 1e-42 57
RALTA_A3122 YP_002007103.1 MerR family transcriptional regulator BAC0182 Protein 2e-36 53
RALTA_A3122 YP_002007103.1 MerR family transcriptional regulator BAC0569 Protein 4e-31 49
RALTA_A3122 YP_002007103.1 MerR family transcriptional regulator BAC0105 Protein 9e-28 46