Gene Information

Name : RALTA_A3062 (RALTA_A3062)
Accession : YP_002007043.1
Strain :
Genome accession: NC_010528
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3231352 - 3231783 bp
Length : 432 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pr : regulator

DNA sequence : 
ATGCGTATCGGCGAACTGTCACGGTCCAGCGGCTGCGATGTCGAGACCATCCGTTACTACGAGCGCGAAGGGCTGCTGGA
CGCCCCCCGGCGCGAGGCCAATGGCTACCGCCGCTATGACGAGGCCCATGTCGTGCAACTGAACTTCGTGCGCCATTGCC
GTTCGCTCGGGATGAGCCTGGCCGACGTCAGGCGGCTGCGCGAGTTCGAGCGCAACCCGTCGCAGGACTGCGACGACATC
AACACGCTGCTGGATCGCCAGATCGCCCAGATCCATGCCCAGCGCGTGGCGCTGGAGTCCCTCGAGGGCCAGCTGCGCGC
GCTGCGCGAAACCTGCCGCCATCACCAGCCCGCCAGCGCCTGCGGCATCCTGCAAAACCTGCAGCAGGCCGCGGCCGGGG
CGGGCTGCGAGTGCCATGCCACCAATGGGTGA

Protein sequence : 
MRIGELSRSSGCDVETIRYYEREGLLDAPRREANGYRRYDEAHVVQLNFVRHCRSLGMSLADVRRLREFERNPSQDCDDI
NTLLDRQIAQIHAQRVALESLEGQLRALRETCRHHQPASACGILQNLQQAAAGAGCECHATNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-30 47
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-30 47
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-30 47
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-30 47
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-30 47
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-30 47
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-30 47
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RALTA_A3062 YP_002007043.1 MerR family transcriptional regulator BAC0301 Protein 3e-25 49
RALTA_A3062 YP_002007043.1 MerR family transcriptional regulator BAC0058 Protein 4e-28 44