Gene Information

Name : RALTA_A3038 (RALTA_A3038)
Accession : YP_002007020.1
Strain :
Genome accession: NC_010528
Putative virulence/resistance : Resistance
Product : arsenate reductase with thioredoxin-like domain
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : 1.20.4.1
Position : 3205852 - 3206211 bp
Length : 360 bp
Strand : -
Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pe : enzyme

DNA sequence :
ATGATCACCATCTACCACAACCCCCGCTGCTCCAAGTCGCGCGAGACCCTCGCCCTGGTCCAGGCCGCCGCCGAGCGGCT
GGCAGAGCCGGTGGAGATCGTGGAGTATTTGAAAGACCCGCCGTCGCTGTCGACGCTGCGCCAGTTGCACACCATGCTGG
GCGTGCCGGTGCGCGAGATGCTGCGCGACAACGAGGCACCCTATGCCGAACTGGGCCTGGCCGATCCCGGCCTGACCGAT
GCCGAGCTGCTGGCGGCAGTGGCCGACAACCCGATCCTGCTGCAGCGCCCGGTGGTGGTACGCAACCGCCGCGCCGCGAT
CGGCCGCCCGCCAGAGAACGTGGCGCCGCTGCTGGCCTGA

Protein sequence :
MITIYHNPRCSKSRETLALVQAAAERLAEPVEIVEYLKDPPSLSTLRQLHTMLGVPVREMLRDNEAPYAELGLADPGLTD
AELLAAVADNPILLQRPVVVRNRRAAIGRPPENVAPLLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-17 43
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 3e-17 42
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 2e-17 42
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 3e-17 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RALTA_A3038 YP_002007020.1 arsenate reductase with thioredoxin-like domain BAC0583 Protein 3e-18 43
RALTA_A3038 YP_002007020.1 arsenate reductase with thioredoxin-like domain BAC0582 Protein 3e-18 42
RALTA_A3038 YP_002007020.1 arsenate reductase with thioredoxin-like domain BAC0584 Protein 1e-18 41