Name : RALTA_A2166 (RALTA_A2166) Accession : YP_002006166.1 Strain : Genome accession: NC_010528 Putative virulence/resistance : Virulence Product : small multidrug resistance protein (smr family) Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2296054 - 2296386 bp Length : 333 bp Strand : + Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pm : membrane component DNA sequence : ATGAACGGATACCTGCTTCTCGCCCTCGCCATCGTTGCCGAAGTCATCGCCACCAGCAGCCTGAAAGCCTCGCAGGGATT TACCCGGCTGCTGCCCAGCGTGCTGGTGGTCACCGGCTACGTCGCCGCTTTTTATCTGCTGATGCTGGTGATGCGCACGG TCCCGGTCGGCATCGCCTATGCGATCTGGAGCGGCGCCGGCATCGTGCTGGTCTCGCTGATCGCGGTGGTGTTGTACCGG CAGGTACCGGACCTGGCGGCGTGTGTCGGGATCGGGCTGATTATTGCCGGCGTGGCGGTGATCCAGCTGTTTTCGAAGAC GAGCGCGCATTGA Protein sequence : MNGYLLLALAIVAEVIATSSLKASQGFTRLLPSVLVVTGYVAAFYLLMLVMRTVPVGIAYAIWSGAGIVLVSLIAVVLYR QVPDLAACVGIGLIIAGVAVIQLFSKTSAH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAD42068.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | BAC0377 | Protein | 1e-13 | 63 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | BAC0002 | Protein | 4e-15 | 60 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | NC_010410.6003348.p0 | Protein | 4e-15 | 60 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | CP004022.1.gene1549. | Protein | 2e-12 | 59 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | BAC0322 | Protein | 2e-13 | 54 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | CP001138.1.gene1489. | Protein | 2e-12 | 54 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | NC_002695.1.913273.p | Protein | 1e-09 | 51 |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | BAC0150 | Protein | 1e-09 | 50 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
RALTA_A2166 | YP_002006166.1 | small multidrug resistance protein (smr family) | VFG1587 | Protein | 6e-09 | 41 |