Gene Information

Name : M446_6685 (M446_6685)
Accession : YP_001773370.1
Strain : Methylobacterium sp. 4-46
Genome accession: NC_010511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 7358695 - 7359399 bp
Length : 705 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mex:Mext_4718 phosphate regulon transcriptional regulatory protein PhoB

DNA sequence :
ATGAGCACGAGGATCCTGATCGTCGAGGATGAGGAGCCGCTGACGCTCCTGCTCCGCTACAACCTCGAAGCCGAGGGCTT
CACGGTGGATGCCGTGGCCCGCGGCGACGAGGCGGATATCCGCCTGCGCGAGCAGGTGCCGGACCTCGTCCTCCTCGACT
GGATGGTGCCGGGGCTGTCGGGCATCGAGCTCTGCCGCCGGATCCGGGCGCGCCGGGAGACCGAGCGGCTGCCGGTCATC
ATGCTCACCGCCCGCGGCGAGGAGGGCGACCGGGTGCGCGGCCTCGCCACCGGCGCCGACGACTACATCGTGAAGCCCTT
CTCGGTGCCGGAGCTGCTGGCGCGGGTGCGGGCGCTGCTGCGCCGCGCCAAGCCGGCCCACGTGGCGCATCTCCTGGTGG
CGGGCGACATCGAGCTCGACCGGGTCAGCCACCGGGTGCGGCGCGAGGGGCGGGAGCTGCATCTCGGCCCGACCGAGTTC
AAGCTGCTCGAATTCCTGATGCAGAGCCCGGGCCGGGTCTTCTCCCGCGAGCAGCTCCTCGACGGCGTCTGGGGCCACGA
CGTCTACATCGACGAGCGCACGGTCGACGTGCATATCGGCCGGCTGCGCAAGGCGATCAACCGGCCGCGCCGCCCCGACC
CGATCCGCACCGTGCGCGGCTCGGGCTACTCCTTCGACGAGATGTTCGCGAACGGCGCCTCCTGA

Protein sequence :
MSTRILIVEDEEPLTLLLRYNLEAEGFTVDAVARGDEADIRLREQVPDLVLLDWMVPGLSGIELCRRIRARRETERLPVI
MLTARGEEGDRVRGLATGADDYIVKPFSVPELLARVRALLRRAKPAHVAHLLVAGDIELDRVSHRVRREGRELHLGPTEF
KLLEFLMQSPGRVFSREQLLDGVWGHDVYIDERTVDVHIGRLRKAINRPRRPDPIRTVRGSGYSFDEMFANGAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-25 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_6685 YP_001773370.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-28 43
M446_6685 YP_001773370.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-24 43
M446_6685 YP_001773370.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-26 42
M446_6685 YP_001773370.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-27 42
M446_6685 YP_001773370.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 42
M446_6685 YP_001773370.1 two component transcriptional regulator BAC0596 Protein 7e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator CP001138.1.gene2239. Protein 7e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator BAC0039 Protein 2e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-24 42
M446_6685 YP_001773370.1 two component transcriptional regulator BAC0197 Protein 2e-20 41
M446_6685 YP_001773370.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-26 41
M446_6685 YP_001773370.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-26 41
M446_6685 YP_001773370.1 two component transcriptional regulator BAC0125 Protein 6e-22 41
M446_6685 YP_001773370.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_6685 YP_001773370.1 two component transcriptional regulator VFG1702 Protein 7e-26 44
M446_6685 YP_001773370.1 two component transcriptional regulator VFG1563 Protein 1e-25 43
M446_6685 YP_001773370.1 two component transcriptional regulator VFG1390 Protein 7e-25 42
M446_6685 YP_001773370.1 two component transcriptional regulator VFG0473 Protein 2e-20 41