Gene Information

Name : M446_6140 (M446_6140)
Accession : YP_001772847.1
Strain : Methylobacterium sp. 4-46
Genome accession: NC_010511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 6757256 - 6757921 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: xau:Xaut_2264 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGGGTGCTCGTCGTGGAGGACGACGCGGCTCTGGCGCGGGGGCTCGTGGCGTCGCTCCGGCTCGCCGGACTCGCGGC
AGACCACGAAGCGGACGGCGAGGACGCGGCGCGGCTCGCCCTCTCGGAGCCCTACAGCCTGATCGTGCTCGACATCGGCC
TTCCGGGCCTCTCCGGCTTCGAGGTGCTGCGGCGCATTCGAGCAGCAGGGAGTACCGTGCCGGTGCTGATCCTGACCGCG
CGCGACGCGGTGGCGGACCGGGTGCGGGGGCTCGATCTCGGGGCGGACGACTACCTGCTCAAGCCTTTCGCCCCCGCCGA
GTTCGAGGCGCGGGTGCGCGCCCAGATCCGGCGCGGTCAGGGCCAGCCCAACCCCGTCCTGCGCTGCGGGACGCTCGCCC
TCGACCGCTCGACCGGGGCGGTGACGCTCGACGGCGAACCCCTTGCGCTCCGGCGCCGGGAACGCGCGGTGCTCACCGTG
CTGATGGCCAAGGCCGGGCAGGTGGTGCCGAAGGAGCGGCTGAACAACGAGGTGTTCGGGTTCGACGACGAGGTGGCGCC
GAACGCCCTCGAACTCTACATCGCGCGCCTGCGCAAGAAGCTGCAGCCGAAGGGACCGGAGATCCGCACGATCCGCGGTC
TCGGCTATCTCCTCGACGCCGGATGA

Protein sequence : 
MRVLVVEDDAALARGLVASLRLAGLAADHEADGEDAARLALSEPYSLIVLDIGLPGLSGFEVLRRIRAAGSTVPVLILTA
RDAVADRVRGLDLGADDYLLKPFAPAEFEARVRAQIRRGQGQPNPVLRCGTLALDRSTGAVTLDGEPLALRRRERAVLTV
LMAKAGQVVPKERLNNEVFGFDDEVAPNALELYIARLRKKLQPKGPEIRTIRGLGYLLDAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-29 44
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_6140 YP_001772847.1 two component transcriptional regulator BAC0487 Protein 4e-34 48
M446_6140 YP_001772847.1 two component transcriptional regulator BAC0083 Protein 1e-32 44
M446_6140 YP_001772847.1 two component transcriptional regulator BAC0638 Protein 2e-28 44
M446_6140 YP_001772847.1 two component transcriptional regulator BAC0197 Protein 1e-31 43
M446_6140 YP_001772847.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 5e-20 42
M446_6140 YP_001772847.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-27 41
M446_6140 YP_001772847.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_6140 YP_001772847.1 two component transcriptional regulator VFG0473 Protein 1e-35 45
M446_6140 YP_001772847.1 two component transcriptional regulator VFG0596 Protein 5e-31 45
M446_6140 YP_001772847.1 two component transcriptional regulator VFG1390 Protein 1e-28 42