Gene Information

Name : M446_3564 (M446_3564)
Accession : YP_001770379.1
Strain : Methylobacterium sp. 4-46
Genome accession: NC_010511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3981496 - 3982188 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sme:SMb21561 putative two component response regulator protein

DNA sequence : 
ATGGCCGAGAGACTGCTCCTCATCGACGACGACCGGCGCCTCGCCGCGATGGTGGCGGAGTACCTCTCGGCCGAGGGCTA
CGCGGTCGCCTGCCAGCCCACGGCGCGGGAGGGCCACGACGCCCTCCGGCGCGAGCGCTTCGACGCCGTGATCCTCGACG
TGATGCTGCCGGACGGCGACGGCTTCGAGCTCTGCCGCCAGATCCGCACCCACTCGCGGGTGCCGATCTTGATGCTGACC
GCCAAGGGCGAGGACACCGACCGCATCATCGGCCTGGAGATCGGGGCCGACGATTACCTGCCCAAGCCCTTCAACCCGCG
CGAGCTGCTCGCGCGCATCCGCGCCCTGCTGCGGCGCCAGCGCGCCCCGCAGGAGGCCCGGCTCGATTTCGGGCGGCTGC
AGATCGATCCCGGATCCCGGGTCGTGCGGCTCGACGGGGTGGAGCGGCGGCTCACCAGCCACCAGTTCGACCTCCTCCTC
GCCTTCGCGACCCATGCCGGGCGGGTGCTCAGCCGCGAGCGGCTGATGGACCTCGTCAAGGGCGAGGATCTCGACGCCTT
CGACCGCTCCATCGACGTGCACGTCTCGCGCCTGCGGGCGCTGATCGAGGACGATCCCCGCCACCCGCGCCGCCTCCTCA
CCATCCGGGGCGCCGGCTACGTCTTCGCCCGCGAGCAGGATGCCGAGCGGTGA

Protein sequence : 
MAERLLLIDDDRRLAAMVAEYLSAEGYAVACQPTAREGHDALRRERFDAVILDVMLPDGDGFELCRQIRTHSRVPILMLT
AKGEDTDRIIGLEIGADDYLPKPFNPRELLARIRALLRRQRAPQEARLDFGRLQIDPGSRVVRLDGVERRLTSHQFDLLL
AFATHAGRVLSRERLMDLVKGEDLDAFDRSIDVHVSRLRALIEDDPRHPRRLLTIRGAGYVFAREQDAER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_3564 YP_001770379.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-24 45
M446_3564 YP_001770379.1 two component transcriptional regulator CP000675.2.gene1535. Protein 5e-29 44
M446_3564 YP_001770379.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-27 44
M446_3564 YP_001770379.1 two component transcriptional regulator CP000034.1.gene3671. Protein 8e-37 43
M446_3564 YP_001770379.1 two component transcriptional regulator NC_008702.1.4607594. Protein 5e-34 42
M446_3564 YP_001770379.1 two component transcriptional regulator BAC0125 Protein 4e-19 41
M446_3564 YP_001770379.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-25 41
M446_3564 YP_001770379.1 two component transcriptional regulator AE016830.1.gene1681. Protein 8e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_3564 YP_001770379.1 two component transcriptional regulator VFG1702 Protein 1e-30 43
M446_3564 YP_001770379.1 two component transcriptional regulator VFG1563 Protein 1e-29 42
M446_3564 YP_001770379.1 two component transcriptional regulator VFG1390 Protein 7e-22 41