Gene Information

Name : M446_0275 (M446_0275)
Accession : YP_001767280.1
Strain : Methylobacterium sp. 4-46
Genome accession: NC_010511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 340816 - 341502 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mex:Mext_0329 response regulator receiver

DNA sequence : 
ATGCGCCTGCTGATCATCGAGGACGACCGCGAGGCGGCGTCCTACCTCGCCAAGGCCTTCCGAGAGGCCGGCCACGTGGC
GGATCTCGCGGCGGACGGCCTCGACGGCTACGCCCTCGCCCGCGAGGGAAGCTACGACGTCCTGGTGGTCGACCGCATGC
TGCCGAAGCTCGACGGGCTGTCGCTGATCCGCTCGCTGCGCGAGCAGGGCGTCGAGACCCCCGTGCTGATCCTGTCGGCG
CTCGGGCAGGTCGACGACCGGGTCAAGGGCCTGCGGGCTGGCGGCGACGATTACGTGCCCAAGCCCTACGCCTTCTCGGA
ACTGCTCGCGCGCGTCGAGGTGCTGGCGCGCCGCCGCGGGGGAGGGGCGGGCGAGCCGACCGCCTACCGGGTCGGCGACC
TCGAACTCGACCGGCTCTCCCACAGGGTCACCCGCGGCGGGCAGGAGATCGTGCTGCAGCCGCGGGAGTTCCGGCTCCTC
GAGTACCTGATGCGCCATGCCGGGCAGGTCGTGACCCGCACGATGCTGCTCGAACACGTCTGGGACTACCATTTCGACCC
CCAGACCAACGTCATCGACGTCCACGTCTCGCGCCTGCGCGCCAAGGTCGACAAGGGCTTCGACCGGCCGATGATCCACA
CCGTGCGGGGGGCCGGCTACATGGTCCGGGCCGGCGGCGAGGCGTGA

Protein sequence : 
MRLLIIEDDREAASYLAKAFREAGHVADLAADGLDGYALAREGSYDVLVVDRMLPKLDGLSLIRSLREQGVETPVLILSA
LGQVDDRVKGLRAGGDDYVPKPYAFSELLARVEVLARRRGGGAGEPTAYRVGDLELDRLSHRVTRGGQEIVLQPREFRLL
EYLMRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKVDKGFDRPMIHTVRGAGYMVRAGGEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-29 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0111 Protein 5e-42 49
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0083 Protein 8e-40 48
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0125 Protein 4e-38 48
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0308 Protein 5e-35 46
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0638 Protein 6e-30 45
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0347 Protein 1e-35 45
M446_0275 YP_001767280.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-21 45
M446_0275 YP_001767280.1 two component transcriptional regulator BAC0197 Protein 1e-33 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_0275 YP_001767280.1 two component transcriptional regulator VFG1389 Protein 5e-26 45
M446_0275 YP_001767280.1 two component transcriptional regulator VFG0596 Protein 3e-29 42
M446_0275 YP_001767280.1 two component transcriptional regulator VFG1390 Protein 5e-29 42
M446_0275 YP_001767280.1 two component transcriptional regulator VFG0473 Protein 4e-21 41