Gene Information

Name : M446_1473 (M446_1473)
Accession : YP_001768413.1
Strain : Methylobacterium sp. 4-46
Genome accession: NC_010511
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1629636 - 1629992 bp
Length : 357 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: azc:AZC_1284 putative transposase

DNA sequence :
ATGATCGGGCCCTCCGGCGTGGTCCGCATCATGCTGGCGACGCGGCCGGTGGACTTCCGCAAGGGCGCTGATGGGCTAGC
CGTGCTGGTGCGCGACGCCTTGGGCACCGATCCGTTCTCCGGCACCGTTTACGTGTTCCGCTTGAAACGAGCGGACAGGG
TCAAGCTTCTGTTCTGGGATGGGAGTGGCGTGGTCCTCGTGGCCAAGCGTCTGGAGGCCGGCCAGTTCTGCTGGCCCAGG
ATCGAGGACGGCGTCGTGCGGCTCACGGCGGCCCAGCTCTCCGCGCTCCTGGAAGGGCTGAACTGGAAGCGCGTGCACGA
GGCCCATAAGGTGACCGTGCCGAGGGTGGCAGGGTAA

Protein sequence :
MIGPSGVVRIMLATRPVDFRKGADGLAVLVRDALGTDPFSGTVYVFRLKRADRVKLLFWDGSGVVLVAKRLEAGQFCWPR
IEDGVVRLTAAQLSALLEGLNWKRVHEAHKVTVPRVAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-20 51
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-15 48
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-15 48
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-16 47
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-16 47
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-16 47
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-16 47
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-16 47
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-16 47
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-16 47
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-16 47
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-18 46
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-18 46
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-16 46
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-16 46
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 9e-11 45
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-18 45
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-15 45
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 3e-10 44
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 5e-10 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-15 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-15 42
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 7e-11 42
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-16 41
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-16 41
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-17 41
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG0792 Protein 2e-16 47
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG1709 Protein 2e-16 47
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG1698 Protein 1e-16 46
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG1517 Protein 4e-11 45
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG1665 Protein 2e-18 45
M446_1473 YP_001768413.1 IS66 Orf2 family protein VFG1052 Protein 5e-16 45