Gene Information

Name : Bcenmc03_2647 (Bcenmc03_2647)
Accession : YP_001765929.1
Strain :
Genome accession: NC_010508
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2949515 - 2950189 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_A5949 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGTGGCCCGATGCGGATTCTGCTTGTCGAAGATGATCGAATGATTGCCGAGGGCGTGCGCAAGGCGCTGCGCTCGGA
CGGCTTTGCGGTCGACTGGGTGCAGGACGGCGACGCCGCGCTCACCGCGCTCGGTGGCGAGACGTACGATCTGCTGCTGC
TTGATCTCGGCCTGCCGAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGGGCGCGGGCTCGCGCTGCCGGTGCTG
ATCGTCACCGCGCGCGATGCGGTCGCCGATCGCGTGAAGGGGCTCGACGCGGGCGCCGACGACTATCTCGTCAAGCCGTT
CGATCTCGACGAGCTCGGCGCGCGGATGCGCGCGCTGATCCGCCGCCAGGCCGGGCGCAGCGAGTCGCTGATCCGCCACG
GCGCGCTGACGCTCGATCCCGCGTCGCACCAGGTGACGCTCGACGGCGCGCCCGTCGCGCTGTCCGCACGCGAGTTCGCG
CTGCTCGAGGCGCTGCTCGCGCGGCCGGGCGCGGTGCTGTCGAAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGA
GGAGATCGGCAGCAACACGGTCGAGGTCTACATCCACGCGCTGCGCAAGAAGCTCGGCTCGGACCTGATCCGCAACGTGC
GCGGGCTCGGCTACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MRGPMRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGDAALTALGGETYDLLLLDLGLPKRDGIDVLRTLRGRGLALPVL
IVTARDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFA
LLEALLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-32 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-20 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator BAC0487 Protein 9e-29 48
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator BAC0197 Protein 1e-24 45
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator BAC0083 Protein 5e-22 44
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-22 43
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator BAC0638 Protein 4e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator VFG0473 Protein 1e-30 48
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator VFG1390 Protein 7e-30 47
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator VFG0596 Protein 7e-21 42
Bcenmc03_2647 YP_001765929.1 two component transcriptional regulator VFG1389 Protein 5e-21 41