Gene Information

Name : Mrad2831_4988 (Mrad2831_4988)
Accession : YP_001757629.1
Strain : Methylobacterium radiotolerans JCM 2831
Genome accession: NC_010505
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5307990 - 5308667 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mex:Mext_1411 response regulator receiver

DNA sequence : 
GTGCGTCTGCTGGTCGTGGAGGATGACAAGGACATCAACCGGCAGGTCGTGGCCGCGCTGGAGGAGGCCGGCTACGTCGC
CGACAAGGCCTATGACGGCGAGGAGGGCGGCTATCTCGGCGAGAGCGAGCCCTACGACGCCATCATCCTCGACATGGGCC
TGCCCAAGGCCGACGGCGTCACGGTGCTGCAGAAGTGGCGCCGGGCCGGCGTGAAGACCCCGGTGATCATCCTCACGGCC
CGCGACCGCTGGTCCGACAAGGTCGACGGCTTCGACGCCGGCGCCGACGACTACGTCACCAAGCCCTTCCACATGGAGGA
GCTGATGGCCCGGGTGCGCGCCCTGCTGCGCCGCGCCGCCGGCCACGCCACCAGCCAGATCGCCTGCGGGCCGGTGACCC
TCGACACGCGCTCCGGCAAGGTCTTCGTCGACGGCGCCCAGGTGAAGCTGACGAGCCACGAGTACCGGCTGCTCTCCTAC
CTGATGCACCATACCGGCCGGGTCGTGTCCCGCGCCGAACTCACCGAGCACCTCTACGACCAGGATTTCGACCGCGACTC
GAACACGATCGAGGTGTTCGTCGGCCGCCTGCGCAAGAAGCTCGCGGTGGACCTGATCCAGACCGTGCGCGGCCTCGGCT
ACCTCGTGGATCCCAACCAGCCGCCGGCGCGGATGTGA

Protein sequence : 
MRLLVVEDDKDINRQVVAALEEAGYVADKAYDGEEGGYLGESEPYDAIILDMGLPKADGVTVLQKWRRAGVKTPVIILTA
RDRWSDKVDGFDAGADDYVTKPFHMEELMARVRALLRRAAGHATSQIACGPVTLDTRSGKVFVDGAQVKLTSHEYRLLSY
LMHHTGRVVSRAELTEHLYDQDFDRDSNTIEVFVGRLRKKLAVDLIQTVRGLGYLVDPNQPPARM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-37 47
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-35 46
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator BAC0530 Protein 9e-36 46
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator CP001918.1.gene2526. Protein 5e-35 45
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator BAC0487 Protein 1e-32 44
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator CP001138.1.gene1939. Protein 5e-37 44
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator NC_002695.1.913289.p Protein 5e-36 43
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator CP000034.1.gene2022. Protein 8e-37 43
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator CP004022.1.gene1005. Protein 2e-37 43
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator BAC0197 Protein 2e-29 42
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator BAC0111 Protein 3e-28 42
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator BAC0308 Protein 6e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator VFG0475 Protein 4e-37 44
Mrad2831_4988 YP_001757629.1 two component transcriptional regulator VFG1389 Protein 4e-25 41