Gene Information

Name : Mrad2831_2339 (Mrad2831_2339)
Accession : YP_001755017.1
Strain : Methylobacterium radiotolerans JCM 2831
Genome accession: NC_010505
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2474331 - 2475026 bp
Length : 696 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mex:Mext_4718 phosphate regulon transcriptional regulatory protein PhoB

DNA sequence :
ATGCAAGTCCTGATCGTCGAGGACGAGGAGGCGCTGACCACGCTGCTGCGCTACAACCTGGAGGCCGAGGGCTTCCTGGT
GGATTCGGCGGCGCGCGGCGACGACGCCGAGCTGCTCCTGGCGGAGCGGATCCCGGACCTCGTCCTGCTCGACTGGATGC
TGCCCGGCCTCTCCGGGATCGAGCTGTGCCGCCGGATCCGGGCGCGCCGGGAGACCGAGCGCCTGCCGGTGATCATGCTC
ACCGCCCGGGGCGAGGAGGGCGACCGCGTCCGCGGTCTCGGCACGGGCGCCGACGACTACATCGTCAAGCCGTTCTCGGT
GCCGGAACTGCTCGCCCGGATCCGCGCGCTGCTGCGCCGGGCCAAGCCCGCCCACGTCTCGGACCGGCTGGCGGCGGGCG
ATTTGGAGCTCGACCGCACCGGCCACCGCGTCCGTCGCGGCGGCGAGGAGCTGCATCTGGGCCCGACAGAGTTCCGGCTG
CTGGAATTCCTGATGCTGGCGCCGGGCCGGGTCTTCTCCCGCGAGCAGCTCCTCGACGGGGTCTGGGGCCACGACGTCTA
CATCGACGAGCGCACGGTGGACGTGCATGTCGGGCGGCTGCGCAAGGCGCTGAACGGCCCGCGCCAGGCCGACCCGATCC
GCACGGTCCGCGGCTCGGGCTACGCCTTCGACGAGACCTTCTCGCTCGAGGCCTGA

Protein sequence :
MQVLIVEDEEALTTLLRYNLEAEGFLVDSAARGDDAELLLAERIPDLVLLDWMLPGLSGIELCRRIRARRETERLPVIML
TARGEEGDRVRGLGTGADDYIVKPFSVPELLARIRALLRRAKPAHVSDRLAAGDLELDRTGHRVRRGGEELHLGPTEFRL
LEFLMLAPGRVFSREQLLDGVWGHDVYIDERTVDVHVGRLRKALNGPRQADPIRTVRGSGYAFDETFSLEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-24 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator BAC0125 Protein 7e-25 44
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-31 44
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-27 43
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-23 43
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-29 43
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-29 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-23 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-24 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-23 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator BAC0039 Protein 2e-23 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator BAC0596 Protein 1e-24 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-23 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-23 42
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-19 41
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-20 41
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-26 41
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator CP001485.1.gene721.p Protein 6e-20 41
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator BAC0197 Protein 1e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator VFG1702 Protein 5e-25 44
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator VFG1390 Protein 6e-26 43
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator VFG1563 Protein 8e-25 43
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator VFG0473 Protein 3e-20 41
Mrad2831_2339 YP_001755017.1 two component transcriptional regulator VFG0596 Protein 2e-22 41