Name : fliQ (Mrad2831_1701) Accession : YP_001754379.1 Strain : Methylobacterium radiotolerans JCM 2831 Genome accession: NC_010505 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 1810478 - 1810744 bp Length : 267 bp Strand : - Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the proteins in this cluster are associated with the thin flagella DNA sequence : ATGAACGAGATCGACGCCCTCGAGCTGGTCCGCTCCGCGATCTGGACCATCATCGTCGCCTCCGGGCCGGCCGTCGGGGC GGCGATGGTCGTGGGCATCCTCATCGCCCTGTTCCAGGCGCTGACACAGATCCAGGAAGTCACCCTGACCTTCGTCCCGA AGATCGTTGTGGTCCTGATCGTGATGATCGTGACCGGCTCCTTCGTCGGCGGCCAGATCTACGCGTTCACCGAGATGGTC TACGGCCGGATCGTCTCGGGGTTCTGA Protein sequence : MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLIVMIVTGSFVGGQIYAFTEMV YGRIVSGF |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 4e-06 | 41 |
escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 4e-06 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
fliQ | YP_001754379.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 8e-08 | 45 |
fliQ | YP_001754379.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 8e-11 | 42 |