Gene Information

Name : fliQ (Mrad2831_1701)
Accession : YP_001754379.1
Strain : Methylobacterium radiotolerans JCM 2831
Genome accession: NC_010505
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 1810478 - 1810744 bp
Length : 267 bp
Strand : -
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the proteins in this cluster are associated with the thin flagella

DNA sequence :
ATGAACGAGATCGACGCCCTCGAGCTGGTCCGCTCCGCGATCTGGACCATCATCGTCGCCTCCGGGCCGGCCGTCGGGGC
GGCGATGGTCGTGGGCATCCTCATCGCCCTGTTCCAGGCGCTGACACAGATCCAGGAAGTCACCCTGACCTTCGTCCCGA
AGATCGTTGTGGTCCTGATCGTGATGATCGTGACCGGCTCCTTCGTCGGCGGCCAGATCTACGCGTTCACCGAGATGGTC
TACGGCCGGATCGTCTCGGGGTTCTGA

Protein sequence :
MNEIDALELVRSAIWTIIVASGPAVGAAMVVGILIALFQALTQIQEVTLTFVPKIVVVLIVMIVTGSFVGGQIYAFTEMV
YGRIVSGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-06 41
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 4e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_001754379.1 flagellar biosynthesis protein FliQ VFG0187 Protein 8e-08 45
fliQ YP_001754379.1 flagellar biosynthesis protein FliQ VFG0395 Protein 8e-11 42