Gene Information

Name : PputW619_0046 (PputW619_0046)
Accession : YP_001746921.1
Strain : Pseudomonas putida W619
Genome accession: NC_010501
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 49585 - 50259 bp
Length : 675 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pmy:Pmen_1174 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence : 
ATGCGCGTTCTAGTTGTGGAAGACGAAATTAAAACTGCCGAATATCTTCAGCAGGGCCTATCCGAAAGCGGGTATGTCGT
AGATATCGTGCACAACGGTGTAGATGCTCTGCACTTGTTCAACACTAATGTCTATTCGTTGGTCCTCCTGGACGTGAACC
TCCCGGGTATCGACGGCTGGGACCTGCTGGAAACCATCCGTAAGACCAGCCGGGTCCGCATCATCATGCTGACCGCCCGC
GGACGCATCAATGACAAGCTCAAGGGCTTGGACGGCGGCGCGGATGACTACCTTGTGAAGCCATTCGAATTCCCTGAGCT
GCTTGCTCGCATCCGTTCGCTGCAACGCCGTGGTGATGAGTTAGTCGAGAAGAGCTCGCTGAAAATTGCCGATCTGGAAC
TCGACTCCGTCCGCCATCGCGTCTTCCGCGGTGGCACACGCATCGATCTCACCACCAAGGAATTTGCGCTTCTGCACCTG
CTCATGAGCCGAACGGGCGAAGCGCTGACTCGCTCTCAGATCATCTCGTTGGTCTGGGATATGAATTTCGATTGCGACAC
CAATGTCATCGATGTAGCCATCCGGCGCTTGCGCTCGAAGATCGATGACCCGTTTGAAACCAAGCTCATTCACACGCTTC
GTGGCGTTGGGTACGTTTTTGAGGAACGCGCATGA

Protein sequence : 
MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVYSLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTAR
GRINDKLKGLDGGADDYLVKPFEFPELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHL
LMSRTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEERA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-49 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-48 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-57 60
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-55 58
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-54 57
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0638 Protein 6e-50 57
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-51 56
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-54 55
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-50 52
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-30 41
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-49 51
PputW619_0046 YP_001746921.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-34 43