
|
Name : PputW619_2339 (PputW619_2339) Accession : YP_001749208.1 Strain : Pseudomonas putida W619 Genome accession: NC_010501 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2612926 - 2613201 bp Length : 276 bp Strand : - Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: rme:Rmet_6173 mercuric transport protein periplasmic component DNA sequence : ATGAAGAAACTGTTTGCCTCCCTCGCCCTCGCCGCCGTTGTTGCCCCCGTCTGGGCCGCCACCCAGACCGTCACGCTGTC CGTACCGGGCATGACCTGCTCCGCCTGCCCGATCACTGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAGTTG ACGTGACTTTCGAGACACGCCAAGCGGTCGTCACCTTCGACGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCAACC GCAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLFASLALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVDVTFETRQAVVTFDDAKTSVQKLTKAT ADAGYPSSVKQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-24 | 89 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-24 | 89 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-24 | 89 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-24 | 89 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-24 | 89 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-24 | 89 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-23 | 84 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-23 | 84 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 1e-22 | 77 |
| merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 2e-21 | 77 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| PputW619_2339 | YP_001749208.1 | mercuric transport protein periplasmic protein | BAC0678 | Protein | 8e-27 | 100 |
| PputW619_2339 | YP_001749208.1 | mercuric transport protein periplasmic protein | BAC0231 | Protein | 2e-25 | 95 |
| PputW619_2339 | YP_001749208.1 | mercuric transport protein periplasmic protein | BAC0679 | Protein | 2e-25 | 95 |
| PputW619_2339 | YP_001749208.1 | mercuric transport protein periplasmic protein | BAC0675 | Protein | 3e-21 | 72 |
| PputW619_2339 | YP_001749208.1 | mercuric transport protein periplasmic protein | BAC0674 | Protein | 2e-17 | 64 |