Gene Information

Name : PputW619_2323 (PputW619_2323)
Accession : YP_001749192.1
Strain : Pseudomonas putida W619
Genome accession: NC_010501
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2601675 - 2602109 bp
Length : 435 bp
Strand : -
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: bxe:Bxe_C1217 transcriptional regulator, MerR family

DNA sequence :
ATGGAAAACAATTTGGAGAATCTGACTATCGGCGTATTCGCCAAGGCGGCCGGGGTCAATGTGGAAACCATCCGGTTCTA
CCAACGCAAGGGCTTGCTGCCTGAGCCGGAGAAGCCCTATGGCGGCATCCGCCGTTACGGTGACGCCGATGTGGCGCGCG
TGCGGTTCGTGAAATCAGCCCAGCGGCTGGGCTTCAGCCTGGATGAGATCGCCGAGCTGCTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGCAGTCTGGCCGAGCACAAGCTCAAGGACGTGCGCGAGAAAATGGCTGACCTGGCGCGCATGGA
GGCCGTGCTGTCTGATTTGGTGTGCGCCTGCCATGCGCGGAAGGGGAACGTTTCCTGCCCGCTGATTGCGTCACTGCAAG
GGAAGAAAGAACCGCGCAGTGCGGACGCGGTGTAG

Protein sequence :
MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPEKPYGGIRRYGDADVARVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASSLAEHKLKDVREKMADLARMEAVLSDLVCACHARKGNVSCPLIASLQGKKEPRSADAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-57 94
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-57 94
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-57 94
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-57 94
merR AGK07025.1 MerR Not tested SGI1 Protein 8e-57 93
merR AGK07083.1 MerR Not tested SGI1 Protein 8e-57 93
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-57 93
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-57 93
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 8e-49 77
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-45 76
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 8e-28 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0688 Protein 1e-63 100
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0232 Protein 6e-58 95
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0687 Protein 6e-58 95
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0684 Protein 2e-58 95
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0683 Protein 3e-58 94
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0689 Protein 2e-55 92
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0686 Protein 5e-60 91
PputW619_2323 YP_001749192.1 putative transcriptional regulator MerR BAC0682 Protein 4e-20 41