Gene Information

Name : EcSMS35_4809 (EcSMS35_4809)
Accession : YP_001746723.1
Strain : Escherichia coli SMS-3-5
Genome accession: NC_010498
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4894438 - 4894635 bp
Length : 198 bp
Strand : +
Note : identified by match to protein family HMM PF06117

DNA sequence :
ATGAAATCATTAACCACAGAAACGGCGCTGGATATTCTGATTGTGTGGCTGCAGGACAATATCGACTGCGAATCGGGAAT
TATCTTTGACAACGATGAGGATAAAACGGATTCGGCAGCACTGTTGCCCTGTATCGAACAGGCCAGGGAGGGTATCCGTA
CCCTGCGCCAACTGCAGCTTCTGCACCAGAACCGATAA

Protein sequence :
MKSLTTETALDILIVWLQDNIDCESGIIFDNDEDKTDSAALLPCIEQAREGIRTLRQLQLLHQNR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL67387.1 L0009-like protein Not tested PAI II CFT073 Protein 5e-23 94
ECO103_3594 YP_003223451.1 hypothetical protein Not tested LEE Protein 2e-21 94
ECO111_3780 YP_003236115.1 hypothetical protein Not tested LEE Protein 9e-23 94
c5147 NP_756995.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-23 94
unnamed ADD91697.1 hypothetical conserved protein Not tested PAI-I AL862 Protein 2e-22 94
unnamed CAI43850.1 hypothetical protein Not tested LEE Protein 2e-22 94
unnamed AAK00484.1 unknown Not tested SHI-1 Protein 1e-21 93
SF3001 NP_708775.1 hypothetical protein Not tested SHI-1 Protein 2e-21 93
Z1225 NP_286759.1 hypothetical protein Not tested TAI Protein 2e-22 93
unnamed AAL08480.1 unknown Not tested SRL Protein 1e-22 93
z1225 CAD33791.1 Z1225 protein Not tested PAI I 536 Protein 3e-22 93
Z1663 NP_287165.1 hypothetical protein Not tested TAI Protein 1e-22 93
unnamed CAE85206.1 hypothetical protein Not tested PAI V 536 Protein 9e-23 93
unnamed CAD66209.1 hypothetical protein Not tested PAI III 536 Protein 1e-21 91
unnamed CAD42103.1 hypothetical protein Not tested PAI II 536 Protein 3e-22 91
unnamed AAC31488.1 L0009 Not tested LEE Protein 8e-16 86
Z5093 NP_290244.1 hypothetical protein Not tested LEE Protein 1e-15 86
unnamed ACU09435.1 conserved hypothetical protein Not tested LEE Protein 8e-16 86
ECs4541 NP_312568.1 hypothetical protein Not tested LEE Protein 1e-15 86

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG0665 Protein 6e-22 93
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG1071 Protein 5e-23 93
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG1532 Protein 1e-22 93
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG1622 Protein 1e-22 91
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG1684 Protein 5e-22 91
EcSMS35_4809 YP_001746723.1 hypothetical protein VFG0788 Protein 3e-16 86