Gene Information

Name : EcSMS35_4782 (EcSMS35_4782)
Accession : YP_001746699.1
Strain : Escherichia coli SMS-3-5
Genome accession: NC_010498
Putative virulence/resistance : Virulence
Product : AlpA family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 4876033 - 4876266 bp
Length : 234 bp
Strand : -
Note : identified by match to protein family HMM PF05930

DNA sequence :
ATGTTGACCACAACAAGCCACGACAGCGTGTTACTGCGTGCCGACGATCCCCTGATCGACATGAACTACATCACCAGTTT
CACCGGCATGACCGATAAATGGTTTTACAAGTTGATCAGTGAAGGCCATTTCCCGAAACCCATCAAGCTGGGCCGCAGCA
GCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGATGCAGCAGCGAATCGAGGAGTCACGAGGAGCAGCAGCATGA

Protein sequence :
MLTTTSHDSVLLRADDPLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWMQQRIEESRGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-31 100
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 9e-32 100
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 6e-25 96
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 6e-25 96
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-17 70
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-18 70
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-17 70
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-17 70
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-17 70

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcSMS35_4782 YP_001746699.1 AlpA family transcriptional regulator VFG1480 Protein 4e-32 100
EcSMS35_4782 YP_001746699.1 AlpA family transcriptional regulator VFG0651 Protein 5e-18 70