Gene Information

Name : EcSMS35_1076 (EcSMS35_1076)
Accession : YP_001743155.1
Strain : Escherichia coli SMS-3-5
Genome accession: NC_010498
Putative virulence/resistance : Virulence
Product : prophage CP4-57 regulatory protein AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1090470 - 1090676 bp
Length : 207 bp
Strand : -
Note : identified by match to protein family HMM PF05930

DNA sequence :
ATGGCTACCCCAGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTGACCGGCCTAACCGATAA
GTGGTTTGACAAACTCATCAAAGATGGGGGCTTTCCTGCGCCCATCAAAATGGGGCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MATPVSLMDDQMVDMAFITQLTGLTDKWFDKLIKDGGFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 5e-25 96
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 5e-25 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 3e-25 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 7e-25 93
unnamed AAL08466.1 unknown Not tested SRL Protein 9e-25 92
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-24 90
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-24 90
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-24 90
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 2e-16 67
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-16 67
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-13 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-13 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcSMS35_1076 YP_001743155.1 prophage CP4-57 regulatory protein AlpA VFG1057 Protein 4e-25 92
EcSMS35_1076 YP_001743155.1 prophage CP4-57 regulatory protein AlpA VFG0651 Protein 4e-25 90
EcSMS35_1076 YP_001743155.1 prophage CP4-57 regulatory protein AlpA VFG1480 Protein 6e-17 67