Gene Information

Name : SYNPCC7002_A0979 (SYNPCC7002_A0979)
Accession : YP_001734238.1
Strain : Synechococcus sp. PCC 7002
Genome accession: NC_010475
Putative virulence/resistance : Virulence
Product : two-component DNA binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1007779 - 1008507 bp
Length : 729 bp
Strand : +
Note : similar to slr0947 in Synechocystis sp. PCC 6803

DNA sequence :
TTGGAAAATCATAAAGAAAGAATTCTTGTCGTTGACGACGAAGCCAGCATCCGCCGCATCCTCGAAACCCGCCTTTCCAT
GATTGGTTACGAGGTTGTGACCGCCGCTGATGGTGAAGAAGCCCTCGCCACATTTGATGAAGCAGACCCCGATCTTGTGG
TTCTTGATGTGATGATGCCCAAGCTCGATGGCTATGGCGTTTGCCAAGAACTCCGCAAAGAATCCGATGTGCCGATTATT
ATGCTCACAGCCCTTGGGGATGTGGCGGACCGCATCACAGGTTTGGAGCTTGGGGCCGATGATTACGTCGTAAAACCATT
CTCCCCCAAAGAACTAGAAGCGCGCATTCGTTCAGTCCTGCGGCGTGTTGAAAAAAATGGTGGTACGGGCATTCCTAGCT
CCGGGGTTATCCATGTGGGTTCGATCCGCATTGATACCAATAAGCGCCAGGTCTACAAAGGCGATGAACGCATTCGACTA
ACAGGGATGGAGTTTAGCCTGTTGGAATTACTGGTCAGCCGTTCTGGGGAACCCTTTTCTCGTTCAGAAATCCTCCAAGA
AGTTTGGGGCTACACCCCAGAGCGCCATGTGGATACCCGCGTTGTGGATGTGCATATTTCCCGGCTGCGCGCCAAACTAG
AAGATGATCCCAGCAATCCCGAACTTATTTTGACAGCCAGAGGTACAGGTTATCTGTTTCAGCGGATCCTCGAACCGGGT
GATGAATAA

Protein sequence :
MENHKERILVVDDEASIRRILETRLSMIGYEVVTAADGEEALATFDEADPDLVVLDVMMPKLDGYGVCQELRKESDVPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVEKNGGTGIPSSGVIHVGSIRIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEPFSRSEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRILEPG
DE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-37 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 42
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 5e-37 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 5e-37 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 5e-37 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 5e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002952.2859905.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_007793.3914279.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_007622.3794472.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002745.1124361.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_009782.5559369.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002951.3237708.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_003923.1003749.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002758.1121668.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_009641.5332272.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_013450.8614421.p0 Protein 1e-47 49
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0125 Protein 1e-39 46
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator AE000516.2.gene3505. Protein 2e-43 46
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_012469.1.7685629. Protein 2e-43 46
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator HE999704.1.gene2815. Protein 4e-41 45
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0638 Protein 7e-29 43
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0083 Protein 3e-36 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator CP001918.1.gene5135. Protein 3e-25 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_012469.1.7686381. Protein 6e-41 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0197 Protein 1e-34 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator CP000034.1.gene3671. Protein 5e-39 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_007793.3914065.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002758.1121390.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_010079.5776364.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002952.2859858.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_007622.3794948.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_003923.1003417.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_013450.8614146.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator NC_002951.3238224.p0 Protein 1e-35 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0308 Protein 2e-36 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator CP000675.2.gene1535. Protein 3e-37 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator HE999704.1.gene1528. Protein 2e-30 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator CP004022.1.gene3215. Protein 5e-34 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator BAC0533 Protein 7e-29 41
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator CP000647.1.gene4257. Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator VFG1389 Protein 5e-34 45
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator VFG1390 Protein 2e-39 44
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator VFG0596 Protein 2e-30 42
SYNPCC7002_A0979 YP_001734238.1 two-component DNA binding response regulator VFG1386 Protein 3e-35 41