Gene Information

Name : SYNPCC7002_A1452 (SYNPCC7002_A1452)
Accession : YP_001734699.1
Strain : Synechococcus sp. PCC 7002
Genome accession: NC_010475
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1526085 - 1526753 bp
Length : 669 bp
Strand : +
Note : similar to alr5188 in Nostoc sp. PCC 7120

DNA sequence :
ATGACCCAGATTCTGATTATCGAAGACGAACCTAGAATCGCTTCCTTCCTCGAAAAGGGGTTTAAGAGCGAAGGCTTTAC
GGTGACCATCGCCAGCACCGCCAAAGAAGCCCTAGACTGGGCCTTGCAATATCCCTTTGCCCTGTTGATCTTAGATTTAG
GCTTGCCCGATGCTGATGGTTTAGAGGTGCTCCATGATCTGCGCGGTCAGGGGGTTACGGCCCCAATTATTATCCTCACG
GCCCGCGACGACCTCGACGACAAAGTAACTGGCTTAAACCTTGGTGCCGACGATTACTTGGGTAAACCGTTTAGTTTTAA
AGAACTCCTGGCCCGTGTCCAAGCGCGGTTACGCACCTTTACCCCAAGGGCGACCCCGGAACCGATGTGTCTGAAAACCC
AGACGTTGGAGCTAGATCTCAAGGCGCGGCGGGTCAGGCAAGGGGATGTTTGGTTAGAGTTGCCCACCCGTGAATTTATC
CTGTTGGAAACGTTGCTCCGCCATCCCGACCAAGTCCTCAGCCGTCAGCAGCTCTTGGATCAGGTGTGGGGCTATGATTA
CGATCCAGGCTCGAATATCGTCGATGTGTACATTGGCTATCTCCGTAAAAAGTTGGGCAGTGATCTCATCGAGACGGTGC
GGGGCATTGGTTATCGCCTCAAGACCTAA

Protein sequence :
MTQILIIEDEPRIASFLEKGFKSEGFTVTIASTAKEALDWALQYPFALLILDLGLPDADGLEVLHDLRGQGVTAPIIILT
ARDDLDDKVTGLNLGADDYLGKPFSFKELLARVQARLRTFTPRATPEPMCLKTQTLELDLKARRVRQGDVWLELPTREFI
LLETLLRHPDQVLSRQQLLDQVWGYDYDPGSNIVDVYIGYLRKKLGSDLIETVRGIGYRLKT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator AE015929.1.gene1106. Protein 1e-35 45
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator BAC0197 Protein 4e-35 44
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-38 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator BAC0125 Protein 1e-39 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator BAC0638 Protein 1e-36 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator BAC0083 Protein 3e-40 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator VFG1389 Protein 2e-41 45
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator VFG1390 Protein 2e-42 43
SYNPCC7002_A1452 YP_001734699.1 two-component response regulator VFG0596 Protein 1e-34 41