Gene Information

Name : emrE (ECDH10B_0499)
Accession : YP_001729444.1
Strain : Escherichia coli K-12
Genome accession: NC_010473
Putative virulence/resistance : Resistance
Product : multidrug efflux protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 506870 - 507202 bp
Length : 333 bp
Strand : +
Note : member of the small MDR (multidrug resistance) family of transporters; in Escherichia coli this protein provides resistance against a number of positively charged compounds including ethidium bromide and erythromycin; proton-dependent secondary transporte

DNA sequence :
ATGAACCCTTATATTTATCTTGGTGGTGCAATACTTGCAGAGGTCATTGGTACAACCTTAATGAAGTTTTCAGAAGGTTT
TACACGGTTATGGCCATCTGTTGGTACAATTATTTGTTATTGTGCATCATTCTGGTTATTAGCTCAGACGCTGGCTTATA
TTCCTACAGGGATTGCTTATGCTATCTGGTCAGGAGTCGGTATTGTCCTGATTAGCTTACTGTCATGGGGATTTTTCGGC
CAACGGCTGGACCTGCCAGCCATTATAGGCATGATGTTGATTTGTGCCGGTGTGTTGATTATTAATTTATTGTCACGAAG
CACACCACATTAA

Protein sequence :
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG
QRLDLPAIIGMMLICAGVLIINLLSRSTPH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-13 44
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-13 44
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-13 44
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-13 44
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-13 44
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-13 44
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-13 44
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-13 44
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-13 44
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-13 44
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-13 44
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-13 44
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-13 44
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-13 44
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-13 44
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-13 44
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-13 44
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-13 44
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-13 44
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-13 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
emrE YP_001729444.1 multidrug efflux protein BAC0150 Protein 3e-46 100
emrE YP_001729444.1 multidrug efflux protein NC_002695.1.913273.p Protein 4e-46 99
emrE YP_001729444.1 multidrug efflux protein CP004022.1.gene1549. Protein 4e-24 59
emrE YP_001729444.1 multidrug efflux protein CP001138.1.gene1489. Protein 4e-24 58
emrE YP_001729444.1 multidrug efflux protein BAC0377 Protein 2e-22 55
emrE YP_001729444.1 multidrug efflux protein NC_010410.6003348.p0 Protein 2e-19 53
emrE YP_001729444.1 multidrug efflux protein BAC0002 Protein 2e-19 53
emrE YP_001729444.1 multidrug efflux protein BAC0324 Protein 3e-19 50
emrE YP_001729444.1 multidrug efflux protein BAC0322 Protein 7e-18 47
emrE YP_001729444.1 multidrug efflux protein BAC0329 Protein 1e-13 47
emrE YP_001729444.1 multidrug efflux protein BAC0249 Protein 3e-11 45
emrE YP_001729444.1 multidrug efflux protein AE000516.2.gene3301. Protein 3e-11 45
emrE YP_001729444.1 multidrug efflux protein BAC0323 Protein 1e-13 44
emrE YP_001729444.1 multidrug efflux protein BAC0327 Protein 3e-15 43
emrE YP_001729444.1 multidrug efflux protein BAC0321 Protein 9e-17 42
emrE YP_001729444.1 multidrug efflux protein BAC0140 Protein 2e-14 41
emrE YP_001729444.1 multidrug efflux protein BAC0325 Protein 5e-13 41