Gene Information

Name : insN-2 (ECDH10B_4478)
Accession : YP_001733037.1
Strain : Escherichia coli K-12
Genome accession: NC_010473
Putative virulence/resistance : Unknown
Product : KpLE2 phage-like element; partial regulator of insertion element IS911B
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4607028 - 4607294 bp
Length : 267 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCGAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGGATTGAAATGGAG
AATGAAATATTAAAAAGGCTACTGTAG

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKRLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-34 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-34 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 7e-33 92
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 7e-33 92
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-25 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-25 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-25 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-18 54
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-18 54
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-18 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 8e-18 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-17 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-17 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-17 52
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-19 48
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 9e-19 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-10 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN-2 YP_001733037.1 KpLE2 phage-like element; partial regulator of insertion element IS911B VFG1485 Protein 1e-34 96
insN-2 YP_001733037.1 KpLE2 phage-like element; partial regulator of insertion element IS911B VFG1123 Protein 6e-26 72
insN-2 YP_001733037.1 KpLE2 phage-like element; partial regulator of insertion element IS911B VFG1553 Protein 1e-23 64
insN-2 YP_001733037.1 KpLE2 phage-like element; partial regulator of insertion element IS911B VFG0784 Protein 3e-18 53
insN-2 YP_001733037.1 KpLE2 phage-like element; partial regulator of insertion element IS911B VFG1566 Protein 4e-11 42