Name : insN-2 (ECDH10B_4478) Accession : YP_001733037.1 Strain : Escherichia coli K-12 Genome accession: NC_010473 Putative virulence/resistance : Unknown Product : KpLE2 phage-like element; partial regulator of insertion element IS911B Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 4607028 - 4607294 bp Length : 267 bp Strand : + Note : - DNA sequence : ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA TGCCGCGAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGGATTGAAATGGAG AATGAAATATTAAAAAGGCTACTGTAG Protein sequence : MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME NEILKRLL |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 3e-34 | 96 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 3e-34 | 96 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 7e-33 | 92 |
insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 7e-33 | 92 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-25 | 72 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-25 | 72 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-25 | 72 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-25 | 72 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-25 | 72 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-25 | 72 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 1e-25 | 72 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 1e-25 | 72 |
unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-23 | 64 |
aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 4e-18 | 54 |
ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 6e-18 | 54 |
unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 8e-18 | 53 |
unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 8e-18 | 53 |
ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 1e-17 | 53 |
Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 1e-17 | 53 |
RS05 | AAP82950.1 | putative transposase | Not tested | PAPI-2 | Protein | 6e-17 | 52 |
tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 3e-19 | 48 |
trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 9e-19 | 47 |
unnamed | CAD42047.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-10 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
insN-2 | YP_001733037.1 | KpLE2 phage-like element; partial regulator of insertion element IS911B | VFG1485 | Protein | 1e-34 | 96 |
insN-2 | YP_001733037.1 | KpLE2 phage-like element; partial regulator of insertion element IS911B | VFG1123 | Protein | 6e-26 | 72 |
insN-2 | YP_001733037.1 | KpLE2 phage-like element; partial regulator of insertion element IS911B | VFG1553 | Protein | 1e-23 | 64 |
insN-2 | YP_001733037.1 | KpLE2 phage-like element; partial regulator of insertion element IS911B | VFG0784 | Protein | 3e-18 | 53 |
insN-2 | YP_001733037.1 | KpLE2 phage-like element; partial regulator of insertion element IS911B | VFG1566 | Protein | 4e-11 | 42 |