Gene Information

Name : EcolC_3448 (EcolC_3448)
Accession : YP_001726390.1
Strain : Escherichia coli ATCC 8739
Genome accession: NC_010468
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3761459 - 3761662 bp
Length : 204 bp
Strand : +
Note : PFAM: protein of unknown function DUF957; KEGG: sfl:SF3001 hypothetical protein

DNA sequence :
ATGGAGAAATTAACCACCGAAGTGGCTCTCAACGTTCTGATTGACTGGCTGCAGGACAACATCGATTGTGGGAACATGAT
TATTTTCGACAACGACGAAGACAACACCGATTCAGCAGTGCTGTTGCCCTGGATTGAACGTGCGCGTCAGGACGTTCGCG
ATCTCCGTCATCTTCAACTTCTGCGACAGACCAGTACAGATTAA

Protein sequence :
MEKLTTEVALNVLIDWLQDNIDCGNMIIFDNDEDNTDSAVLLPWIERARQDVRDLRHLQLLRQTSTD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5147 NP_756995.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-16 75
Z1225 NP_286759.1 hypothetical protein Not tested TAI Protein 4e-17 75
unnamed AAL67387.1 L0009-like protein Not tested PAI II CFT073 Protein 1e-16 75
unnamed AAL08480.1 unknown Not tested SRL Protein 3e-17 75
Z1663 NP_287165.1 hypothetical protein Not tested TAI Protein 3e-17 75
ECO111_3780 YP_003236115.1 hypothetical protein Not tested LEE Protein 2e-16 74
ECO103_3594 YP_003223451.1 hypothetical protein Not tested LEE Protein 5e-15 72
unnamed CAD42103.1 hypothetical protein Not tested PAI II 536 Protein 1e-15 72
unnamed CAE85206.1 hypothetical protein Not tested PAI V 536 Protein 3e-16 72
SF3001 NP_708775.1 hypothetical protein Not tested SHI-1 Protein 5e-15 69
unnamed AAK00484.1 unknown Not tested SHI-1 Protein 4e-15 69
unnamed AAC31488.1 L0009 Not tested LEE Protein 2e-10 68
Z5093 NP_290244.1 hypothetical protein Not tested LEE Protein 3e-10 68
unnamed ACU09435.1 conserved hypothetical protein Not tested LEE Protein 2e-10 68
ECs4541 NP_312568.1 hypothetical protein Not tested LEE Protein 3e-10 68
unnamed ADD91697.1 hypothetical conserved protein Not tested PAI-I AL862 Protein 2e-15 68
unnamed CAI43850.1 hypothetical protein Not tested LEE Protein 2e-15 68
z1225 CAD33791.1 Z1225 protein Not tested PAI I 536 Protein 2e-15 68
unnamed CAD66209.1 hypothetical protein Not tested PAI III 536 Protein 8e-15 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3448 YP_001726390.1 hypothetical protein VFG1071 Protein 1e-17 75
EcolC_3448 YP_001726390.1 hypothetical protein VFG1622 Protein 4e-16 72
EcolC_3448 YP_001726390.1 hypothetical protein VFG0665 Protein 2e-15 69
EcolC_3448 YP_001726390.1 hypothetical protein VFG0788 Protein 8e-11 68
EcolC_3448 YP_001726390.1 hypothetical protein VFG1532 Protein 8e-16 68
EcolC_3448 YP_001726390.1 hypothetical protein VFG1684 Protein 3e-15 68