|
Name : EcolC_3448 (EcolC_3448) Accession : YP_001726390.1 Strain : Escherichia coli ATCC 8739 Genome accession: NC_010468 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 3761459 - 3761662 bp Length : 204 bp Strand : + Note : PFAM: protein of unknown function DUF957; KEGG: sfl:SF3001 hypothetical protein DNA sequence : ATGGAGAAATTAACCACCGAAGTGGCTCTCAACGTTCTGATTGACTGGCTGCAGGACAACATCGATTGTGGGAACATGAT TATTTTCGACAACGACGAAGACAACACCGATTCAGCAGTGCTGTTGCCCTGGATTGAACGTGCGCGTCAGGACGTTCGCG ATCTCCGTCATCTTCAACTTCTGCGACAGACCAGTACAGATTAA Protein sequence : MEKLTTEVALNVLIDWLQDNIDCGNMIIFDNDEDNTDSAVLLPWIERARQDVRDLRHLQLLRQTSTD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| c5147 | NP_756995.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 2e-16 | 75 |
| Z1225 | NP_286759.1 | hypothetical protein | Not tested | TAI | Protein | 4e-17 | 75 |
| unnamed | AAL67387.1 | L0009-like protein | Not tested | PAI II CFT073 | Protein | 1e-16 | 75 |
| unnamed | AAL08480.1 | unknown | Not tested | SRL | Protein | 3e-17 | 75 |
| Z1663 | NP_287165.1 | hypothetical protein | Not tested | TAI | Protein | 3e-17 | 75 |
| ECO111_3780 | YP_003236115.1 | hypothetical protein | Not tested | LEE | Protein | 2e-16 | 74 |
| ECO103_3594 | YP_003223451.1 | hypothetical protein | Not tested | LEE | Protein | 5e-15 | 72 |
| unnamed | CAD42103.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-15 | 72 |
| unnamed | CAE85206.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 3e-16 | 72 |
| SF3001 | NP_708775.1 | hypothetical protein | Not tested | SHI-1 | Protein | 5e-15 | 69 |
| unnamed | AAK00484.1 | unknown | Not tested | SHI-1 | Protein | 4e-15 | 69 |
| unnamed | AAC31488.1 | L0009 | Not tested | LEE | Protein | 2e-10 | 68 |
| Z5093 | NP_290244.1 | hypothetical protein | Not tested | LEE | Protein | 3e-10 | 68 |
| unnamed | ACU09435.1 | conserved hypothetical protein | Not tested | LEE | Protein | 2e-10 | 68 |
| ECs4541 | NP_312568.1 | hypothetical protein | Not tested | LEE | Protein | 3e-10 | 68 |
| unnamed | CAI43850.1 | hypothetical protein | Not tested | LEE | Protein | 2e-15 | 68 |
| z1225 | CAD33791.1 | Z1225 protein | Not tested | PAI I 536 | Protein | 2e-15 | 68 |
| unnamed | CAD66209.1 | hypothetical protein | Not tested | PAI III 536 | Protein | 8e-15 | 68 |
| unnamed | ADD91697.1 | hypothetical conserved protein | Not tested | PAI-I AL862 | Protein | 2e-15 | 68 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG1071 | Protein | 1e-17 | 75 |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG1622 | Protein | 4e-16 | 72 |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG0665 | Protein | 2e-15 | 69 |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG0788 | Protein | 8e-11 | 68 |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG1532 | Protein | 8e-16 | 68 |
| EcolC_3448 | YP_001726390.1 | hypothetical protein | VFG1684 | Protein | 3e-15 | 68 |
