Gene Information

Name : EcolC_3444 (EcolC_3444)
Accession : YP_001726386.1
Strain : Escherichia coli ATCC 8739
Genome accession: NC_010468
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3759907 - 3760128 bp
Length : 222 bp
Strand : +
Note : PFAM: protein of unknown function DUF987; KEGG: sfx:S3202 hypothetical protein

DNA sequence :
ATGAAAATTATCAGTAAACGTCAGGCTATGGCGATATACCGCCAGCATCCGCAGTCCCGGTTGTTTCCCTTCTGCACGGG
TAAATACAAATGGTCTGGCAGCATCTGCCACTACGCTGGGCAGGAGGTTCAGGATATCAGCGGTGTGCTCGCGGTCTTCG
CTGAACGCCGTCAGAACCGCAACGGCCCCTATGTCGTATTACGCAGCGTCACGCTGAATTAA

Protein sequence :
MKIISKRQAMAIYRQHPQSRLFPFCTGKYKWSGSICHYAGQEVQDISGVLAVFAERRQNRNGPYVVLRSVTLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 4e-18 74
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 8e-21 72
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 7e-21 72
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 6e-21 72
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 9e-21 72
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 9e-21 72
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 2e-20 70
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-20 70
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 2e-20 70
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 2e-20 70
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-20 70
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 2e-20 70
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 9e-21 70
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 5e-20 69
unnamed AAL08476.1 unknown Not tested SRL Protein 4e-20 69
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 5e-20 69
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 2e-19 68
unnamed AAL57578.1 unknown Not tested LEE Protein 2e-17 66
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 2e-17 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcolC_3444 YP_001726386.1 hypothetical protein VFG0661 Protein 3e-21 72
EcolC_3444 YP_001726386.1 hypothetical protein VFG1618 Protein 3e-21 72
EcolC_3444 YP_001726386.1 hypothetical protein VFG1679 Protein 3e-21 72
EcolC_3444 YP_001726386.1 hypothetical protein VFG1529 Protein 1e-20 70
EcolC_3444 YP_001726386.1 hypothetical protein VFG1067 Protein 1e-20 69