Gene Information

Name : YPK_3140 (YPK_3140)
Accession : YP_001721864.1
Strain : Yersinia pseudotuberculosis YPIII
Genome accession: NC_010465
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3432473 - 3432679 bp
Length : 207 bp
Strand : +
Note : PFAM: Prophage CP4-57 regulatory; KEGG: eca:ECA2863 hypothetical protein

DNA sequence :
ATGACAACCGAATACAGCGTACTTAACGATCAACTGGTAACAATGGCCTTTATCACCAAACTAACCGGCTTAACGGATAA
ATGGTTCTATAAGCTCATCTCATTGGGTCAGTTTCCCAGGCCAATTAAACTGGGCAGAAGCTCACGTTGGTTGCAAAGTG
AAGTTGAAATTTGGCTGCAGCAGCGTATTGAACAGTCCCGCCAGTAA

Protein sequence :
MTTEYSVLNDQLVTMAFITKLTGLTDKWFYKLISLGQFPRPIKLGRSSRWLQSEVEIWLQQRIEQSRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-20 75
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-19 74
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 5e-20 73
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 7e-20 73
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 7e-20 73
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 2e-19 73
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 2e-19 73
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-18 72
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 6e-18 72
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-19 71
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 7e-14 68
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 7e-14 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YPK_3140 YP_001721864.1 phage transcriptional regulator AlpA VFG0651 Protein 2e-20 73
YPK_3140 YP_001721864.1 phage transcriptional regulator AlpA VFG1480 Protein 2e-18 72
YPK_3140 YP_001721864.1 phage transcriptional regulator AlpA VFG1057 Protein 9e-20 71