Gene Information

Name : YPK_1914 (YPK_1914)
Accession : YP_001720658.1
Strain : Yersinia pseudotuberculosis YPIII
Genome accession: NC_010465
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2122843 - 2123175 bp
Length : 333 bp
Strand : +
Note : PFAM: small multidrug resistance protein; KEGG: ypm:YP_2119 quaternary ammonium compound-resistance protein

DNA sequence :
ATGAGCAGTTTTGTCTATTTATTTATGGCGATTATTGCCGAAGTAGTTGCAACGACGATGCTAAAAGCATCCGATGGTTT
TTCTCGATTAGTCCCTTCAGTGGTGGTCGTGATTGGTTATGGTATTGCTTTTTGGGGGCTTTCGCAGGTAGTCAAAACCA
TGCCGCTGGGTATTGCTTATGCGATTTGGTCCGGTTTGGGGATTGTACTGGTCTCAATCGCTGCCACCTTTATGTATCAA
CAAAAGCTGGATTGGGCGGCGGTTGTCGGTATGGCGCTGATTATTTCGGGTGTTATGGTGATTAACCTCCTGTCCAAGAC
ACCGATGCATTAA

Protein sequence :
MSSFVYLFMAIIAEVVATTMLKASDGFSRLVPSVVVVIGYGIAFWGLSQVVKTMPLGIAYAIWSGLGIVLVSIAATFMYQ
QKLDWAAVVGMALIISGVMVINLLSKTPMH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-19 51
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-18 51
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-19 51
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-19 51
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-18 51
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-19 51
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-18 51
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-19 51
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-19 51
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-19 51
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-19 51
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-19 51
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-19 51
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-19 51
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-18 51
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-19 51
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-19 51
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-18 51
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-19 51
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-19 51
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 8e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0377 Protein 6e-37 76
YPK_1914 YP_001720658.1 small multidrug resistance protein CP004022.1.gene1549. Protein 8e-35 73
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0324 Protein 6e-22 58
YPK_1914 YP_001720658.1 small multidrug resistance protein CP001138.1.gene1489. Protein 3e-23 57
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0322 Protein 6e-23 55
YPK_1914 YP_001720658.1 small multidrug resistance protein NC_002695.1.913273.p Protein 3e-21 53
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0002 Protein 2e-20 52
YPK_1914 YP_001720658.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-20 52
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0150 Protein 4e-21 51
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0323 Protein 4e-19 51
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0329 Protein 3e-16 44
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0192 Protein 3e-14 43
YPK_1914 YP_001720658.1 small multidrug resistance protein BAC0140 Protein 6e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YPK_1914 YP_001720658.1 small multidrug resistance protein VFG1586 Protein 3e-16 42