Gene Information

Name : Daud_1897 (Daud_1897)
Accession : YP_001718022.1
Strain : Candidatus Desulforudis audaxviator MP104C
Genome accession: NC_010424
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1999472 - 2000155 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mta:Moth_0827 two component transcriptional regulator, winged helix family

DNA sequence :
TTGCACGCCGGCGTGATTTTAATGGTTGAGGACGAGGCGGCGGTCCGGGACGTAGCCCGGTTGTACCTGGAAAAGGAGGG
TTTTCGGGTGGTGCCGGCCCTCGACGGGGAACAGGCCCTGGAACAACTGACCGCGGTGAACCCTGACCTGGTGATCCTGG
ACATCATGCTGCCCAAGAAGGACGGATGGAGTGTTTGCCGCGAGATCCGGCGGCAAACGGCCGTACCGATCATCATGCTT
TCGGCCAAGGGCGAGGAGTACGACCGGGTGCTCGGGCTGGAACTCGGTGCCGACGACTACGTCACCAAACCTTTCAGCCC
AAGGGAACTGGTGGCCCGGGTCAAAGCCGTCCTGCGCCGGAGCAATGCCCCGGCGGGCACGGGGGCCGGACCGGCGCTCC
GCTACCCGGGACTGACCATCGACACGGAGGCACGCCGGGTGGAGGTTGAAGGGCAGCCCATCGCGCTCACCCCCAAGGAA
TTCGAATTGCTGGCCTTTCTGGCTTCCCGGCCCCGGCGGGTTTTCAGCCGGGAGCAACTTCTGGCCGGTGTCTGGGATTA
CGAGTACCCCGGGGACACGCGCACCGTGGATACCCACATCAAGCGGCTGCGGGAGAAGCTCCGGGGCACAGGGCGGAACT
ACCTAAAGACAGTTTGGGGACTCGGCTATAAGTTTGAGGTGTAA

Protein sequence :
MHAGVILMVEDEAAVRDVARLYLEKEGFRVVPALDGEQALEQLTAVNPDLVILDIMLPKKDGWSVCREIRRQTAVPIIML
SAKGEEYDRVLGLELGADDYVTKPFSPRELVARVKAVLRRSNAPAGTGAGPALRYPGLTIDTEARRVEVEGQPIALTPKE
FELLAFLASRPRRVFSREQLLAGVWDYEYPGDTRTVDTHIKRLREKLRGTGRNYLKTVWGLGYKFEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-40 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-39 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-52 50
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-48 49
Daud_1897 YP_001718022.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-46 47
Daud_1897 YP_001718022.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-47 47
Daud_1897 YP_001718022.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-49 47
Daud_1897 YP_001718022.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-41 45
Daud_1897 YP_001718022.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-36 45
Daud_1897 YP_001718022.1 two component transcriptional regulator BAC0039 Protein 6e-37 45
Daud_1897 YP_001718022.1 two component transcriptional regulator CP000034.1.gene2186. Protein 6e-37 45
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-37 45
Daud_1897 YP_001718022.1 two component transcriptional regulator AM180355.1.gene1830. Protein 5e-41 44
Daud_1897 YP_001718022.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-28 44
Daud_1897 YP_001718022.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-36 44
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 6e-40 43
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-39 43
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 6e-40 43
Daud_1897 YP_001718022.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-38 43
Daud_1897 YP_001718022.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-41 43
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-43 43
Daud_1897 YP_001718022.1 two component transcriptional regulator CP001138.1.gene4273. Protein 7e-32 43
Daud_1897 YP_001718022.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 7e-38 43
Daud_1897 YP_001718022.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-36 43
Daud_1897 YP_001718022.1 two component transcriptional regulator BAC0596 Protein 1e-36 43
Daud_1897 YP_001718022.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-36 43
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-39 42
Daud_1897 YP_001718022.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-33 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-40 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-40 42
Daud_1897 YP_001718022.1 two component transcriptional regulator BAC0197 Protein 3e-33 42
Daud_1897 YP_001718022.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-44 42
Daud_1897 YP_001718022.1 two component transcriptional regulator NC_002695.1.915041.p Protein 9e-32 42
Daud_1897 YP_001718022.1 two component transcriptional regulator CP000647.1.gene4257. Protein 2e-32 42
Daud_1897 YP_001718022.1 two component transcriptional regulator CP000034.1.gene3834. Protein 9e-32 42
Daud_1897 YP_001718022.1 two component transcriptional regulator BAC0533 Protein 2e-32 42
Daud_1897 YP_001718022.1 two component transcriptional regulator CP000034.1.gene3671. Protein 5e-40 42
Daud_1897 YP_001718022.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-38 41
Daud_1897 YP_001718022.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Daud_1897 YP_001718022.1 two component transcriptional regulator VFG1389 Protein 2e-33 46
Daud_1897 YP_001718022.1 two component transcriptional regulator VFG1563 Protein 1e-40 44
Daud_1897 YP_001718022.1 two component transcriptional regulator VFG1702 Protein 4e-40 44
Daud_1897 YP_001718022.1 two component transcriptional regulator VFG0596 Protein 5e-29 41