Gene Information

Name : aacC1 (ABAYE3573)
Accession : YP_001715324.1
Strain : Acinetobacter baumannii AYE
Genome accession: NC_010410
Putative virulence/resistance : Resistance
Product : gentamicin 3'-acetyltransferase (gentamicin acetyltransferase I) (aminoglycoside N(3')-acetyltransferase I) (AAC(3)-I)
Function : -
COG functional category : R : General function prediction only
COG ID : COG0456
EC number : 2.3.1.60
Position : 3623865 - 3624398 bp
Length : 534 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 2549372; Product type e : enzyme

DNA sequence :
ATGTTACGCAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGTGGCTCAAGTATGGGCATCAT
TCGCACATGTAGGCTCGGCCCTGACCAAGTCAAATCCATGAGGGCTGCTCTTGATCTTTTCGGTCGTGAGTTCGGAGACG
TAGCCACCTACTCCCAACATCAGCCGGACTCCGATTACCTCGGGAACTTGCTCCGTAGTAAGACATTCATCGCGCTTGCT
GCCTTCGACCAAGAAGCGGTTGTTGGCGCTCTCGCGGCTTACGTTCTGCCAAAGTTTGAGCAGGCGCGTAGTGAGATCTA
TATCTATGATCTCGCAGTCTCCGGCGAGCACCGGAGGCAAGGCATTGCCACCGCGCTCATCAATCTCCTCAAGCATGAGG
CCAACGCGCTTGGTGCTTATGTGATCTACGTGCAAGCAGATTACGGTGACGATCCCGCAGTGGCTCTCTATACAAAGTTG
GGCATACGGGAAGAAGTGATGCACTTTGATATCGACCCAAGTACCGCCACCTAA

Protein sequence :
MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALA
AFDQEAVVGALAAYVLPKFEQARSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKL
GIREEVMHFDIDPSTAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 7e-80 100
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 7e-80 100
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 7e-80 100
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 6e-69 100
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 1e-79 100
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 4e-69 100
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 1e-79 100
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 4e-69 100
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 4e-69 100
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 9e-44 63
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-34 54
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-34 54
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-34 54
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-34 54
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 4e-34 54
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 4e-34 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
aacC1 YP_001715324.1 gentamicin 3'-acetyltransferase (gentamicin acetyltransferase I) (aminoglycoside N(3')-acetyltransferase I) (AAC(3)-I) NC_011586.7045205.p0 Protein 3e-80 100
aacC1 YP_001715324.1 gentamicin 3'-acetyltransferase (gentamicin acetyltransferase I) (aminoglycoside N(3')-acetyltransferase I) (AAC(3)-I) NC_010410.6002585.p0 Protein 3e-80 100
aacC1 YP_001715324.1 gentamicin 3'-acetyltransferase (gentamicin acetyltransferase I) (aminoglycoside N(3')-acetyltransferase I) (AAC(3)-I) U04610.gene.p01 Protein 9e-80 99
aacC1 YP_001715324.1 gentamicin 3'-acetyltransferase (gentamicin acetyltransferase I) (aminoglycoside N(3')-acetyltransferase I) (AAC(3)-I) AF318077.1.gene3.p01 Protein 1e-68 97